(data stored in ACNUC30630 zone)

EMBL: CP002049.PE450

CP002049.PE450       Location/Qualifiers
FT   CDS_pept        complement(500867..501931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0456"
FT                   /product="peptidase M24"
FT                   /note="COGs: COG0006 Xaa-Pro aminopeptidase; InterPro
FT                   IPR001131:IPR001714:IPR000587:IPR000994; KEGG: ttj:TTHA1068
FT                   proline dipeptidase; PFAM: peptidase M24; creatinase; SPTR:
FT                   Q5SJE6 Proline dipeptidase; PFAM: Metallopeptidase family
FT                   M24; Creatinase/Prolidase N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13593"
FT                   /db_xref="GOA:D7CS61"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS61"
FT                   /protein_id="ADI13593.1"
FT                   /translation="MLAPVWEGLRAAGADALLVTHPANVRYLSGFSSPEDGRVLLSDKG
FT                   LQLWTDGRYIQQAREESRLEVVITDTGSTWVEQLCTHVKDVLGGPRLAFEAESTPYALF
FT                   AELREALGSEPVPTKGLVSELRLVKSPAEIATLREAARITDEAFAHILDVIRPGLREVD
FT                   VALELERFMRRAGAEGASFAIIVASGVRSAMPHGVASSKPLARGELVTLDFGAKVAGYH
FT                   ADMTRTVALGEVSEAHERLYDAVLRAQEAALAAVAPNAEGRAVDAVARDSLAAAGLAEG
FT                   FTHGLGHGVGLEVHERPRLSRLSQDTLRPGMVVTVEPGVYRPGDAGVRIEDLVVVTDAG
FT                   CERLSGSPKALLRL"
     atgctagcgc ccgtctggga gggcttgcgc gcggcggggg cggacgcctt gctggtgaca        60
     caccccgcca acgtgcgcta cttgtcgggg ttttcgtcgc ccgaagacgg ccgcgtgctg       120
     ctctccgaca agggcttgca gctctggacc gacgggcgct acatccaaca agcccgcgag       180
     gagtcgcgcc tcgaggtcgt gatcaccgat acggggtcga cgtgggtaga gcagctctgc       240
     acgcacgtca aagacgttct gggcggccct cggctcgcct tcgaggccga gagcaccccc       300
     tacgcgctct ttgcggagct gcgcgaggcg ctcggcagcg aaccggtgcc gaccaagggg       360
     ctcgtcagcg agctgcgcct cgtcaagtcg cccgccgaga tcgcaaccct acgcgaggcc       420
     gcgcgcatca ccgacgaggc gtttgcgcac atcctcgacg tcattcgacc ggggctgcgt       480
     gaagtcgacg tcgctctgga gctcgagcgc tttatgcgcc gcgcgggcgc cgaaggggcg       540
     tcgtttgcga tcatcgtcgc ttcgggtgtg cgcagcgcga tgccccacgg ggtagcctcg       600
     agcaaaccgc tcgcacgcgg cgagctcgtc accctcgact tcggcgccaa agtggcgggc       660
     tatcacgccg acatgacccg cacggtcgcc ctcggggagg tgagcgaagc gcacgaacgg       720
     ctctacgacg cggtgctgag ggcgcaggag gcggcccttg cggccgtcgc ccccaacgcg       780
     gaggggcgcg cggtcgacgc ggtcgcccgc gacagcttgg ccgccgcggg tttggcggag       840
     gggtttaccc acggcctcgg ccacggcgtc ggtctggagg ttcacgagcg gccgcggttg       900
     tctcggctct cacaggacac cctccgcccc ggcatggtcg tcaccgtcga accgggagta       960
     taccggcccg gcgacgcggg ggtgcgcatc gaagacctcg tagtcgtcac cgacgcgggg      1020
     tgcgaacggc tctccgggag cccaaaggcg ctgcttcggc tctag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page