(data stored in ACNUC30630 zone)

EMBL: CP002049.PE456

CP002049.PE456       Location/Qualifiers
FT   CDS_pept        complement(509476..510465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0462"
FT                   /product="von Willebrand factor type A"
FT                   /note="InterPro IPR002035; KEGG: cya:CYA_2093 hypothetical
FT                   protein; PFAM: von Willebrand factor type A; SMART: von
FT                   Willebrand factor type A; SPTR: Q2JSY1 Putative
FT                   uncharacterized protein; PFAM: von Willebrand factor type A
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13599"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS67"
FT                   /protein_id="ADI13599.1"
FT                   /translation="MKRFWLPLVAVLALLGGCDRVQSIIDDVVTPADAVINGYTVERDA
FT                   NGDPTGNVALNVSALDSAGEPIAGRLSNPRATVTSVTPLPGLAAAQRYTATATITVDIT
FT                   VQEVINAVLNMDRSGSMRLNDPERLRVDAAKSFLERVTPEDRIAVMEFPGQSSGFRAST
FT                   LLQGFTSDKALLEAALDRVGQRGNTPIWDSLLDTLDLHAADEGGQGASRVVLLFTDGER
FT                   EGGQVAFGEALAAALESDVRVFTIGLGSDIDTAELQELAAETGGTFANVASAAELEELF
FT                   QRAFNAIRASGTITLSISPIPPPGSLVRGTLSFTVNGEDFTVDYAFTI"
     atgaaacgct tttggctccc cctcgtcgcg gtgctcgcgc tgcttggcgg ttgcgaccgc        60
     gtgcaaagta tcattgatga cgtcgtcacc cccgcagacg cggtcatcaa cggctacacc       120
     gtcgagcgcg acgcgaacgg cgacccgacc ggcaacgtgg ccctcaacgt cagcgcccta       180
     gacagcgccg gcgagcccat cgccggcagg ctcagcaacc cgcgcgcgac cgtcaccagc       240
     gtgacgcccc tccccggcct cgccgccgcg cagcgctaca ccgcgactgc caccatcact       300
     gtcgacatca ccgtgcagga ggtcatcaac gccgtattga acatggaccg cagcggcagc       360
     atgcggctca acgacccgga gcgcctccgt gtagacgccg ccaagagctt tctggagcgc       420
     gtcaccccgg aagaccgcat cgcggtgatg gagtttccag ggcagtcgtc gggctttcgc       480
     gcttcgacgc tgctgcaggg ctttacgagc gacaaagccc tcttagaagc cgccctcgac       540
     agggtcgggc agcgcggcaa cacccccatc tgggattcac tgctcgacac cctcgacctc       600
     cacgccgccg acgagggggg gcagggcgcc tcgcgcgtgg tgctgctctt taccgacggt       660
     gagcgcgagg gcggtcaggt ggccttcggc gaagccctcg cagccgcgct ggagagcgac       720
     gtgcgggtct ttaccatcgg cctgggcagc gacatcgaca ccgccgagct gcaggagctc       780
     gccgccgaaa cgggcgggac gttcgccaac gtcgcgagcg ccgcggagct cgaggaactc       840
     ttccagaggg cctttaacgc catccgcgcc tcggggacca tcacgctcag catctcgccc       900
     atcccgcccc cagggtcgct cgtccggggc acgctgtcgt ttaccgtcaa cggcgaggac       960
     ttcacggtcg actacgcttt cacgatctag                                        990
//

If you have problems or comments...

PBIL Back to PBIL home page