(data stored in ACNUC30630 zone)

EMBL: CP002049.PE458

CP002049.PE458       Location/Qualifiers
FT   CDS_pept        complement(513936..515054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0464"
FT                   /product="transcriptional regulator, GntR family with LacI
FT                   sensor"
FT                   /note="COGs: COG1609 Transcriptional regulators; InterPro
FT                   IPR000524:IPR001761:IPR011991; KEGG: gym:GYMC10_2719
FT                   transcriptional regulator, GntR family with LacI sensor;
FT                   PFAM: regulatory protein GntR HTH; periplasmic binding
FT                   protein/LacI transcriptional regulator; SMART: regulatory
FT                   protein GntR HTH; SPTR: Q2RGW9 Transcriptional regulator,
FT                   LacI family; manually curated; PFAM: Bacterial regulatory
FT                   proteins, gntR family; family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13601"
FT                   /db_xref="GOA:D7CS69"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS69"
FT                   /protein_id="ADI13601.1"
FT                   /translation="MTAPPAQGNNFAVDRSSQKPLHQQLCEHYRQLIEGGVLPVGSRLP
FT                   TELELMAKHGVSRGTVREALRGLHEAGLVRRTTKIGTVVQSPPQPAVSARRIIGVVFPQ
FT                   THDAFCLDIMKGVQTACRERGYHAAFGYSHFSSAVERAEVSRMRSAGFGGVLVLPHDDP
FT                   TLFRELVANTYPFVYIDQKFEAAPSDFVGVDNVSASFTVTEHLIGLGHRHIGFIHRNPS
FT                   LDQAPSTVKERYRGYRAALTAHAVPFESSWLVEIARNADPKAFLALTSQVDAVVAANDH
FT                   TALKFLDVATKAGVRVPEEIALVGFDDLPLAAEFALTTVAQPSREIGLRAAHLLIDRIE
FT                   GKGGPPQHVILPTHLVVRATCGQNLRASTKGR"
     atgactgctc cccccgcgca aggcaacaac ttcgccgtcg accgaagctc ccaaaaaccc        60
     ctgcatcagc aactttgtga gcattaccgg cagctaatag agggcggcgt tctacccgta       120
     ggtagtcgcc tgccaaccga gctcgagctg atggccaagc atggggtcag tcgtggaacc       180
     gtacgtgagg cgctccgagg acttcacgaa gcgggtctcg tgcggcgcac gacaaagatc       240
     ggtacggtgg tgcagtcccc gccgcagcca gctgtctcgg cacggcgcat tatcggggtt       300
     gtctttccac agacgcacga cgctttctgt ctagacatta tgaaaggtgt acagacggcg       360
     tgtcgcgaac ggggctatca cgcagcgttc ggttactcgc actttagcag tgcggtcgag       420
     cgcgctgaag tgtcgcggat gcgtagcgcc ggtttcggcg gtgtcttagt gctacctcac       480
     gacgatccga ccctctttcg cgagcttgta gcaaacacct acccgttcgt gtacatcgac       540
     cagaagttcg aggcagcacc gagtgacttc gtcggcgtgg ataacgtcag cgccagcttt       600
     accgtcactg agcaccttat cggtctaggc cataggcaca tcggctttat acaccgaaac       660
     cctagccttg accaggcgcc ctctacggtc aaagaacggt atagaggcta ccgagcagcg       720
     ctcactgccc acgcagtgcc gtttgaaagc tcttggctcg tggagatcgc gcgtaatgcc       780
     gatccaaaag cctttttggc cctgacctcc caagtcgacg cggtcgtagc tgcaaacgac       840
     cacaccgccc tgaagtttct agacgtcgca accaaagccg gggtcagggt gcccgaggag       900
     atcgcgctcg ttggcttcga cgacctgcca ctagccgccg agttcgccct gacgaccgtg       960
     gcgcagccca gtcgggagat cggtctgcgc gccgcccacc tcctcatcga ccgcattgag      1020
     ggcaaggggg ggccgccaca gcacgtcatc ttgcccacgc acctcgtggt gcgagcgacc      1080
     tgcgggcaaa acctgcgcgc ctctacaaaa ggacggtag                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page