(data stored in ACNUC30630 zone)

EMBL: CP002049.PE462

CP002049.PE462       Location/Qualifiers
FT   CDS_pept        complement(518493..519083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0468"
FT                   /product="protein of unknown function DUF624"
FT                   /note="COGs: COG5578 integral membrane protein; InterPro
FT                   IPR006938; KEGG: ttr:Tter_1502 protein of unknown function
FT                   DUF624; PFAM: protein of unknown function DUF624; SPTR:
FT                   D1CC93 Putative uncharacterized protein; PFAM: Protein of
FT                   unknown function, DUF624"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13605"
FT                   /db_xref="GOA:D7CS73"
FT                   /db_xref="InterPro:IPR006938"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS73"
FT                   /protein_id="ADI13605.1"
FT                   /translation="MRLLDSRLYWWLNRLSSYVLLGGLWLLLSSPVVTFFPATAALFAV
FT                   FRAWQDNPDDAFYLPFFGRLRARFVSDALLGLLWLLIGALLLINAVLLPQLALPARLIA
FT                   FASLSLAAVLYTAASAFIFPVRVSTELGVWASARAAVILGMSQLGTTLLCVLAVALAAG
FT                   AFWLFPPTLLLSGVGVAHLTYWLCHRTLKRLAT"
     atgagacttc tcgacagccg tctctactgg tggctcaacc gcctgagcag ctacgtgctg        60
     ctggggggct tgtggctcct tctctcctct cctgtcgtca ccttcttccc ggctaccgcg       120
     gctctcttcg ccgtgttccg ggcgtggcaa gacaatcccg acgacgcttt ctacctgccc       180
     tttttcgggc gactccgcgc acgcttcgtc agcgacgcgc tcctcgggct actttggctg       240
     ctcatcggcg cgctgctgct catcaatgcg gtgttgctgc cacagttggc gctgcccgcg       300
     cgcctcatcg ctttcgcctc cttgtcgctc gccgccgtac tctacacagc cgcgagcgcg       360
     tttatcttcc ccgtgcgggt cagcacggag ctgggggttt gggccagcgc tcgagccgcg       420
     gtgatcttgg gcatgtcaca gctcgggaca accctgctct gcgtgcttgc ggttgcgctc       480
     gccgccggcg ccttctggct ctttccgccg accctgctgc tcagcggcgt cggggtcgcg       540
     cacctcacct actggctctg tcatcgcacc ctaaaacgcc tcgctacttg a                591
//

If you have problems or comments...

PBIL Back to PBIL home page