(data stored in ACNUC30630 zone)

EMBL: CP002049.PE471

CP002049.PE471       Location/Qualifiers
FT   CDS_pept        529298..530236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0477"
FT                   /product="ABC transporter related protein"
FT                   /note="COGs: COG1131 ABC-type multidrug transport system
FT                   ATPase component; InterPro IPR003439:IPR003593; KEGG:
FT                   scl:sce0659 sodium ABC transporter ATP-binding protein;
FT                   PFAM: ABC transporter related; SMART: AAA ATPase; SPTR:
FT                   A9EN41 Sodium ABC transporter ATP-binding protein; PFAM:
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13614"
FT                   /db_xref="GOA:D7CS82"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS82"
FT                   /protein_id="ADI13614.1"
FT                   /translation="MERRKSLPLQASESAFKGISEPLIAASELHKSFPPRKAVLKGVDL
FT                   TLYAGEVVGLLGLNGAGKTTLIKLLTGLLEPDAGSVTLLGRARDRQGVRRHVALMKEGQ
FT                   PTLFEFMTPRQNLRYYGGLLGVRDLAAGVARVLAEVELTEVADTPLLYLSNGTKRRVGL
FT                   ALAYLKGARVLLLDEPSAGLDIRSTALMKGALKAFAAAGNAVLLTGHEMGFLESVCDRV
FT                   VVLHGGRVAAEGTLRALLQRFAPEQWVEVWLEGRPGAGELLEEQGGLFRVRLPLAELGA
FT                   LGALRVRQLRLETPALEALLREVGDVARRVA"
     atggaacgac gaaagagcct accgctacaa gcttccgaga gtgcttttaa gggtatctca        60
     gagcccctta tagcggcctc tgagctccac aaatcctttc cgccccgtaa ggctgtcctt       120
     aagggcgtcg acctcacgct ctacgcgggc gaggtcgtcg ggttgttggg cctcaatggc       180
     gccggcaaaa cgacgctcat caagctcctg acggggctcc tcgagcccga cgcggggagc       240
     gtcaccctgc tcggccgcgc ccgggaccgg cagggggtgc ggcggcacgt ggcactcatg       300
     aaagaggggc agccgacgct ctttgagttc atgaccccgc gccaaaacct ccgctactac       360
     ggcggcctgc tcggcgtacg cgacctcgcc gcgggggtcg cgcgggtgct cgcagaggtc       420
     gagctcaccg aggtggccga cacgcccctc ttgtacctct cgaacggcac caaacgccgc       480
     gtcgggctcg cgctcgctta cctcaagggc gcgcgcgtgc tgctcctcga cgagccgagc       540
     gcggggctcg acatccggag caccgcgctc atgaaagggg cgcttaaagc ctttgccgcg       600
     gccggcaacg cggtgcttct aacggggcac gagatggggt ttttggagtc ggtgtgcgac       660
     cgggtggtgg tgctgcacgg cgggcgcgtc gccgccgagg ggacgctgcg ggcgcttttg       720
     cagcgcttcg cccccgagca gtgggtggag gtgtggctcg agggtcgccc cggcgcgggg       780
     gagcttttgg aggagcaggg cgggctcttt cgggtgcggc tgccactggc ggagctcggg       840
     gcgctcgggg cgctgcgggt gcggcagctg cggctcgaga cccccgccct cgaggcgctg       900
     ttgcgcgagg tgggtgatgt ggcgcgccga gtggcttag                              939
//

If you have problems or comments...

PBIL Back to PBIL home page