(data stored in ACNUC30630 zone)

EMBL: CP002049.PE473

CP002049.PE473       Location/Qualifiers
FT   CDS_pept        complement(530966..531547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0479"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="COGs: COG0127 Xanthosine triphosphate
FT                   pyrophosphatase; InterPro IPR002637; KEGG: ttj:TTHA1654
FT                   nucleoside-triphosphatase (HAM1 protein); PFAM: Ham1 family
FT                   protein; SPTR: A1HQF7 Nucleoside-triphosphatase; TIGRFAM:
FT                   non-canonical purine NTP pyrophosphatase, rdgB/HAM1 family;
FT                   PFAM: Ham1 family; TIGRFAM: non-canonical purine NTP
FT                   pyrophosphatase, rdgB/HAM1 family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13616"
FT                   /db_xref="GOA:D7CS84"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS84"
FT                   /protein_id="ADI13616.1"
FT                   /translation="MKLALATANEDKVREFRRALAQSPLTLVSARELGVTDFPAETGAS
FT                   YAANALTKAAFLAGRTGLLSLADDSGLEVDALGGAPGLYSARFASGSDLERTAHLLAQL
FT                   RGVPEGERRARFVCVLGLVTPAGDAHTFEGRCDGVILEAPRGAGGFGYDPVFWSPELGK
FT                   TFAEATPEEKAAVSHRGRALAELAAWLQAR"
     gtgaagctcg cgctcgcgac cgccaacgag gacaaggtgc gcgagtttcg gcgcgcgctc        60
     gcccagagtc cgctgacgct cgtctcggcg cgcgagctcg gcgtcaccga cttccccgcc       120
     gagacgggcg cttcgtacgc ggccaacgcc ctgaccaaag cggcttttct cgcggggcgc       180
     acggggctct taagcctcgc cgacgactcg gggctcgagg tcgacgccct gggcggcgcc       240
     cccggcctct acagcgcccg cttcgctagc gggagcgacc tcgagcgcac cgcgcacctc       300
     ttggcgcagc tgcggggggt tccggagggg gagcgaaggg cgcgattcgt ctgcgtgctc       360
     gggctcgtca cccccgcggg ggacgcccac accttcgagg gccgctgcga cggggtgatc       420
     ttagaggcgc ccaggggcgc gggcggcttc ggctacgacc cggtgttctg gagccccgag       480
     ctgggcaaga ccttcgccga ggccaccccc gaggaaaaag cggcggtgag ccaccgcggg       540
     cgcgcgctcg cagagctcgc cgcgtggttg caggcgcgct aa                          582
//

If you have problems or comments...

PBIL Back to PBIL home page