(data stored in ACNUC30630 zone)

EMBL: CP002049.PE478

CP002049.PE478       Location/Qualifiers
FT   CDS_pept        536288..537586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0484"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tth:TTC0207 hypothetical protein; SPTR: C1XKD7
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13621"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS89"
FT                   /protein_id="ADI13621.1"
FT                   /translation="MTTEFTYCLTRICLRTGQLTLPLSMRELFPAPGSVRAVDTKTGDS
FT                   LELQVTASHQLLGVAPFLARHGLAVNDLLSVRALPDGAYAITPLPRPKRPDYTRPEAQR
FT                   ELIDRIVEQAPLSEREIRALFPDLPPEFDLGAALQRDGRLTKYEGRWGFAVPDAAPAAP
FT                   RPYPTVTTFVARSGEASFARPSEAPSTDTSQSALLRRALETFGFRVEAHAHGHLVAHAE
FT                   LGRRHYTVLAHLLAEGARLDWTKLLARRRELSSTYLAVFGSHHDLLRLRAPAAGAGATL
FT                   WSWEALERALGLLATVPLSPVDLEPHFVKEGLFDEGLRRFERTIERRVAERGAFSQVLS
FT                   RLAGLRAPSVFLLDDVVDGAAPSREEVLKVLELLGEAPFHLVSRVDSGEFCLRQGVPES
FT                   LTHLSAYALSLVERLPERRTERVRGVAVLAADE"
     atgacgacgg agtttaccta ctgcctgacg cgcatctgct tgcgcacggg gcagctcacc        60
     ctaccgcttt cgatgcgcga gcttttcccc gcgcccggct ccgtgcgcgc ggtcgacacg       120
     aaaaccggcg acagcctcga gctgcaggtc accgcctcgc accagctcct gggcgtcgcg       180
     ccctttctcg cccgccatgg gcttgcggtc aacgacctct tgagcgtgcg cgcgctcccc       240
     gacggcgcct acgcgatcac ccccttgccg aggcccaaac gccccgacta cacccgcccc       300
     gaggcgcagc gcgagctgat cgaccgcatc gtcgagcagg cgcccttgtc cgagcgggag       360
     atccgcgccc tcttccccga tctgccccct gagttcgacc tcggcgccgc gctgcagcgc       420
     gacggacggc tgaccaagta cgaggggcgc tggggtttcg cggttcccga cgccgccccc       480
     gccgcgccgc gcccctaccc gaccgtgacg accttcgtcg cgcgcagcgg cgaggcgtcg       540
     tttgcgcgcc cctcggaggc gccgagcacc gacacctcgc agagcgcgct gttgcgccgc       600
     gctctagaga ccttcggctt ccgcgtcgag gcgcacgcgc acggccacct cgtcgcgcac       660
     gccgagctcg ggcggcgcca ctacacggtg ctcgctcacc tcctggcgga aggggcgcgg       720
     ctcgactgga cgaagctcct agcccgccgc cgcgagctga gcagcaccta cctggccgtt       780
     tttggcagcc accacgacct gctgcggctg cgcgcccccg ccgcgggtgc cggcgcgacg       840
     ctctggtcgt gggaggcgtt ggagcgcgcc ttggggctct tggcgaccgt accgctaagc       900
     cccgtcgacc tcgaaccgca cttcgtcaaa gaggggcttt tcgacgaggg gttgcgccgc       960
     ttcgagcgca ccatcgagcg ccgcgtcgcc gagcgggggg cgttttcgca ggtgctctcg      1020
     cgcctcgcgg ggctgcgcgc gccctcggtg tttctgctcg acgacgtcgt cgacggcgcc      1080
     gcgccctccc gcgaggaggt gctcaaggtg ctcgagctcc tcggggaagc gccctttcac      1140
     ctcgtgagcc gcgtcgactc gggcgagttc tgcttgcgcc agggcgtccc ggagagcctc      1200
     acgcacctct cggcttacgc cctgtcgctc gtcgaacggc tgcccgagcg ccgcaccgag      1260
     cgcgtgcgcg gggtcgcggt gctcgcggcg gacgagtag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page