(data stored in ACNUC30630 zone)

EMBL: CP002049.PE487

CP002049.PE487       Location/Qualifiers
FT   CDS_pept        544435..545499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="InterPro IPR011048; KEGG: mes:Meso_4007 hypothetical
FT                   protein; SPTR: C1XGI5 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13630"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS98"
FT                   /protein_id="ADI13630.1"
FT                   /translation="MAVLDLLSEEVLASFSVPGPGGNVYRSPSGQYGLVVHRDENRVTV
FT                   VHSGLRLEDHGDHADLVQGAPYILQTLNVGRQPTHVWTGEHEIAIFNDADGTVAVLDER
FT                   LFGLSLEYLGLESAGPDHGAAVVLGDHVLVGYLELGRVDAFTRGGELETSFEGCPRLHG
FT                   EASAGDVAAFGCADGVLLVTYEEGALSAVKLDNPAGTPEDARVGTVVAHEASPVMVGNL
FT                   GDGVVLIDAAAQTLEPVSLPSAPLRFAFDHTGEHLLVLTRDGELHRLEAQSGELQGSVS
FT                   VMEAFDPGPGGGHGAARPGLAVGEHAVYVSVPSAGEVAEVRFEGDALSVTRRLEVGGTP
FT                   SGVALLALEGGVIH"
     gtggcggtgc tcgacctgct gagcgaagag gtgctcgcga gctttagcgt gccgggaccg        60
     ggggggaacg tgtaccgctc gccgagcggg cagtacggcc tcgtcgtgca ccgcgacgaa       120
     aaccgcgtca cggtggtgca ctcggggttg cgcctagagg accacggcga ccacgccgac       180
     ctcgtgcagg gcgcgccgta catcctccag accctcaacg tcgggcgcca acccacccac       240
     gtgtggacgg gcgagcacga gatcgccatc tttaacgacg ccgacgggac cgtggcggtg       300
     ctcgacgaac gccttttcgg gctctcgctc gagtacctcg gtctcgagtc cgcggggccc       360
     gaccacgggg cggcggtcgt gctcggcgac cacgtgctcg tcggctactt ggagttgggg       420
     cgcgtcgacg cgtttacccg gggcggcgag cttgaaacga gcttcgaggg gtgcccgcgg       480
     ctgcacggtg aggcctcggc gggcgacgtg gcggctttcg gctgcgccga cggcgtgctg       540
     ctcgtcacct acgaggaggg cgcgctgagc gcggtgaagc tggacaatcc cgccgggacg       600
     cccgaagacg cgcgggtcgg tacggtcgtc gcccacgagg ctagccccgt gatggtcggc       660
     aacttgggtg acggcgtggt gctcatcgac gcggcggcgc agacgctcga gcccgtctct       720
     ctgccgagcg cgccgctgcg ctttgccttc gaccacacgg gcgagcacct cttggtgctg       780
     acgcgcgacg gcgagctgca ccgcctcgag gcgcaatcag gggagctcca gggcagcgtg       840
     tcggtcatgg aagcgttcga cccgggcccg ggcggcgggc acggtgcggc gcgccctggg       900
     ctggcggtcg gcgaacacgc cgtctacgtc agcgtgccga gcgcgggcga ggtcgccgag       960
     gtgcgctttg agggcgacgc gctcagcgtg acgcgccgcc tagaggtcgg ggggaccccg      1020
     agcggcgtgg cgctgctcgc gttagagggc ggtgtgatcc actag                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page