(data stored in ACNUC30630 zone)

EMBL: CP002049.PE488

CP002049.PE488       Location/Qualifiers
FT   CDS_pept        545519..546811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0494"
FT                   /product="hypothetical protein"
FT                   /note="InterPro IPR000815; KEGG: cyn:Cyan7425_1918
FT                   hypothetical protein; SPTR: B8HT58 Putative uncharacterized
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13631"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7CS99"
FT                   /protein_id="ADI13631.1"
FT                   /translation="MRPLSDVPLTVVGGRGPHGLALHLLLQDRGVSGYRLLDKAADWLP
FT                   LYGPGGPMQAVGHLRSPAELDFALGVPERGMGAFEDDDGSFPLRGVYRLEDAAASAFNL
FT                   STTPAHRAPRLAFWRYANCVARRSGADAHVLQASAARLEPVWEGAEGHWRVHLEDGRSF
FT                   ATAAVVLATGLGPHLRVPRPWRPWWARLPEATRAHVLGFRYEGLAGKRVVVAGSSNLSS
FT                   WEAAIRAAEAGAKVTLLSRALNPIEWQLPFAPHWFQADFMARFMALSPEKRLRTLRKTH
FT                   VPNTSLPGLAARARALGVRVTFYARVQAAAPLWGGVQLQYRTPEGDHAEYADLLLAATG
FT                   AAPRLRELPLIAETAREHRAPVVVGGPAKHRPILDDTGRWKNLPPLYPMGAHALTRGGL
FT                   GVNTLASATAYLPLTLPHIARAAGLALPKSA"
     gtgcgtccgc taagcgacgt tccgctcacc gtcgtcggcg ggcgaggccc gcacggcctc        60
     gccctgcacc tcctcttgca agaccgcggg gtgagcggct accggctgct cgacaaggct       120
     gccgactggc tcccgctcta cggcccgggt ggccccatgc aggcggtcgg gcacctgcgc       180
     agccccgccg agctcgactt tgcgctgggc gtccccgagc gggggatggg cgctttcgag       240
     gacgacgacg gcagcttccc gcttcggggc gtctaccgcc tcgaggacgc ggccgcgagc       300
     gccttcaacc tgagcaccac gccagcacac cgcgccccgc gcctcgcgtt ctggcgctac       360
     gcgaactgcg tcgcgcggcg tagcggcgcc gacgcccacg tgctgcaggc cagcgccgcg       420
     cgcctcgagc ccgtgtggga aggcgccgag gggcactggc gcgtacacct agaggacggc       480
     cgcagcttcg cgacggcggc cgtggtgctc gcgacggggc ttgggccgca cctgcgcgtc       540
     ccgcggccgt ggcgcccctg gtgggcgcgc ctgccggagg cgacgcgggc gcacgtgctc       600
     ggtttccgct acgaggggct cgcgggtaag cgcgtcgtgg tggccggttc gtccaacctc       660
     tcgagctggg aggccgccat ccgcgccgcc gaagcgggcg ccaaggtgac gctgctctcg       720
     cgcgcgctca accccatcga gtggcagctg cccttcgcgc cgcactggtt ccaggcggac       780
     tttatggcgc gctttatggc gctgtctccc gaaaagcgcc tccgcacgct gcgcaaaacg       840
     cacgtgccca acacctcgct gccggggcta gcggcgcggg cgcgcgcgct cggggtgcgc       900
     gtcacgttct acgcccgcgt gcaggccgcc gcgccgctct ggggtggggt gcagctgcag       960
     taccgcacgc cggagggcga ccacgccgag tacgccgacc tcctgctcgc ggcgacgggc      1020
     gccgcgccgc ggctgcggga gctgccgctt atcgccgaga ccgcgcgcga gcaccgcgcc      1080
     cccgtggtgg tgggcggccc cgccaaacac cgcccgatcc tggacgacac cgggcgctgg      1140
     aagaacctgc cgccgctgta cccgatgggg gcgcacgcgc tgacgcgcgg cgggctcggc      1200
     gtcaacaccc tcgcgagcgc cacggcctac ttgccgctga cgctgccgca catcgcgcgc      1260
     gccgcggggt tagcgctgcc gaaaagcgcc tga                                   1293
//

If you have problems or comments...

PBIL Back to PBIL home page