(data stored in ACNUC30630 zone)

EMBL: CP002049.PE491

CP002049.PE491       Location/Qualifiers
FT   CDS_pept        547747..549015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0497"
FT                   /product="Kelch repeat-containing protein"
FT                   /note="InterPro IPR006652:IPR011043:IPR015915; KEGG:
FT                   xcb:XC_4204 ring canal kelch-like protein; PFAM: Kelch
FT                   repeat-containing protein; SPTR: C1XWE6 Uncharacterized
FT                   conserved protein; PFAM: Kelch motif"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13634"
FT                   /db_xref="GOA:D7CSA2"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR030104"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA2"
FT                   /protein_id="ADI13634.1"
FT                   /translation="MNRFATRPHRSWRALLWAPLGLLSACYAPGGPTPDNRPPTVSAGG
FT                   DRTVTLPADGVLLAGRAADPDGDPLTALWAQLAGPAEVTFADASALETSARFPEAGAYT
FT                   LELSVTDGQASARDQAVITVEPGAGGAGAWRALPESAAPRQEVSYVQLGGRFYLAGGST
FT                   LHEVYDPVARTWTEVAPLPRNLDHIQGVAVGGKILYIGGNVGGDLRVETDTVYIYDPET
FT                   DTFTEGSPMPRGRGAGGVAVHDGLIYYAGGLNGFVARTWFDVYDPVADTWTALPDMPNP
FT                   RDHFHAVVLDGVFYAIGGREARINATTPAVDAFDIASGTWTTLDTELPTERGGFAAAVL
FT                   GDEILVIGGEGGGNTYEEVEAYNPRTNTWRRLAPMPTPRHGVQAAVCNGGVYLAAGGVV
FT                   QGIGPSSAHEVFFVGEPRPCEAP"
     atgaaccgtt tcgcgacccg cccccaccgc tcgtggcgcg ccctgctgtg ggcgcccttg        60
     gggttgctct cggcctgcta cgcgccgggc ggccccacgc cggacaaccg tccccctacc       120
     gtctcggccg ggggcgaccg aaccgtcacg ctgcccgccg acggggtgct cctggcgggc       180
     cgcgccgcgg accccgacgg cgaccccctc acggcgctct gggcgcagct cgcgggtccc       240
     gccgaggtga cgtttgccga cgcgagcgct ctagagacca gcgcgcgctt tccggaagcg       300
     ggggcgtaca cgctcgagct ctccgtcacc gacggccaag ccagcgcccg tgatcaggcc       360
     gtcatcaccg tagaaccggg cgctggtggc gctggcgcgt ggagggcgct tcccgaaagc       420
     gcggcgccgc gccaggaggt ctcgtacgtg cagctcggcg ggcgcttcta cctcgccggc       480
     ggcagcacgc tgcacgaggt ctacgacccc gtggcgcgga cctggacgga ggtcgcgccg       540
     ctccccagaa acctcgacca catccaaggg gtcgcggtcg gcgggaagat cctctacatc       600
     ggcggcaatg tgggcggcga cctgcgcgta gagaccgaca ccgtctacat ctacgacccc       660
     gaaaccgaca cctttaccga gggttcgccg atgccgcgcg ggcgcggtgc ggggggcgtg       720
     gcggtccacg acggcctcat ctactacgcc gggggcttaa acggcttcgt ggcgcggacc       780
     tggttcgacg tctacgaccc cgtagcggac acctggaccg cgctgcccga catgcccaac       840
     ccccgcgacc acttccacgc ggtggtgttg gacggggtgt tctacgccat cggcgggcgc       900
     gaggcgcgca tcaacgccac gacccccgcc gtggacgcct tcgacatcgc cagcggcacc       960
     tggacgaccc tggacaccga gctgccgacc gagcgcggcg gtttcgccgc ggcggtgctg      1020
     ggggatgaga tcttggtcat cggcggcgag gggggcggca acacctacga ggaggtcgag      1080
     gcgtacaacc cgcgcacgaa cacctggcgg cgcctcgccc ccatgccgac gccccgccac      1140
     ggcgtccagg cggcggtctg taacggcggg gtctacctcg cggcgggcgg ggtggtgcag      1200
     ggcatcgggc cctcgagcgc ccacgaggtg tttttcgtgg gcgagccccg gccctgcgag      1260
     gcgccctga                                                              1269
//

If you have problems or comments...

PBIL Back to PBIL home page