(data stored in ACNUC30630 zone)

EMBL: CP002049.PE493

CP002049.PE493       Location/Qualifiers
FT   CDS_pept        complement(550036..550362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0499"
FT                   /product="glutaredoxin"
FT                   /note="InterPro IPR002109:IPR012336:IPR012335; KEGG:
FT                   tth:TTC1680 hypothetical protein; PFAM: glutaredoxin; SPTR:
FT                   Q72H15 Putative uncharacterized protein; PFAM:
FT                   Glutaredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13636"
FT                   /db_xref="GOA:D7CSA4"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA4"
FT                   /protein_id="ADI13636.1"
FT                   /translation="MNAPESAPPVRLYGLAGCGPCEVAKRFLSSRGVPFTFVDVAREPE
FT                   RRNLLEARLGSPARGVILEDGDTLEVMQGVSVAVLSRWLSAYRERHGFTPWPRRGTPSR
FT                   RQRS"
     gtgaacgccc ccgagagcgc cccgccggtg cggctctacg gcctggcggg gtgcggccct        60
     tgcgaagtgg cgaaacgctt cttgagctcg aggggcgtgc cgtttacgtt cgtcgacgtc       120
     gcccgggaac cggagcggcg caacctgtta gaggcgcgcc tcgggtcgcc ggcgcggggg       180
     gtcatcctcg aggacggcga cacgctagag gtcatgcagg gcgtttcggt ggcggtcctg       240
     tcgcgttggc tgtcggctta ccgggagcgg cacgggttta ctccctggcc tcgacgcggt       300
     acaccgtccc gtcggcaaag gagctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page