(data stored in ACNUC30630 zone)

EMBL: CP002049.PE495

CP002049.PE495       Location/Qualifiers
FT   CDS_pept        complement(551284..551553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dra:DR_0202 hypothetical protein; SPTR: Q9RXV4
FT                   Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13638"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSA6"
FT                   /protein_id="ADI13638.1"
FT                   /translation="MRRVAVVGTKLWRLFKRTLRRIATRDVLWGTNEETFRQAFLRRKS
FT                   LLLCKTHWRGRRRYEAHFATLLPHVRLLRLFEPAEAERLLKGLR"
     atgcggcgcg tcgccgtcgt cggcaccaag ctctggcggc tctttaagcg gacattgcgc        60
     cgcatagcga cccgcgacgt gctgtggggg acgaacgagg aaacgttccg ccaggcgttt       120
     ttgcgccgga agtccctctt gttatgcaag acgcactggc gcgggcgccg ccgctatgag       180
     gcgcacttcg cgaccctact gccccacgtg aggctgctgc ggctctttga acccgccgag       240
     gcggagaggc tcctcaaagg cctaagataa                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page