(data stored in ACNUC30630 zone)

EMBL: CP002049.PE5

CP002049.PE5         Location/Qualifiers
FT   CDS_pept        complement(5962..6411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0005"
FT                   /product="ribosomal protein L9"
FT                   /note="COGs: COG0359 Ribosomal protein L9; InterPro
FT                   IPR020594:IPR020070:IPR020069:IPR009027; KEGG: ttj:TTHA0242
FT                   50S ribosomal protein L9; PFAM: Ribosomal protein L9-like;
FT                   SPTR: B7A904 Ribosomal protein L9; TIGRFAM: ribosomal
FT                   protein L9; PFAM: Ribosomal protein L9, N-terminal domain;
FT                   Ribosomal protein L9, C-terminal domain; TIGRFAM: ribosomal
FT                   protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13148"
FT                   /db_xref="GOA:D7CWQ7"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWQ7"
FT                   /protein_id="ADI13148.1"
FT                   /translation="MNVILLEPVEKLGEAGDLVSVKPGFARNFLVPRGLALPATQANQR
FT                   ELEARLAQRAKQLAERKADAERLKEMLAEAQLEIPVRAGEDRIYGSVTARDIAEALEKR
FT                   FEVTIDRRKLDLHEPIKTLGEYTVVYKPHPEVPIDLKVAVVAENA"
     atgaacgtca tcctgctcga accggttgaa aaactcggcg aagcggggga cttggtctcg        60
     gtcaaaccgg ggtttgcgcg caactttctg gtaccgcgcg gcctcgccct gcccgcgacg       120
     caggccaatc agcgcgagct agaggcgcgc ttggcgcagc gggcgaagca gctcgccgaa       180
     cgcaaagccg acgccgagcg ccttaaagag atgctcgccg aggcgcagct cgagatcccg       240
     gtgcgcgccg gtgaagaccg catctacggc tcggtcacgg cgcgcgacat cgccgaggcg       300
     cttgaaaagc gcttcgaggt caccatcgac cgccgcaagc tcgacctgca cgagccgatc       360
     aaaaccctcg gcgagtacac cgtggtctac aaaccccacc ccgaagtgcc catcgacctc       420
     aaggtcgcgg tcgtcgcgga gaacgcgtaa                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page