(data stored in ACNUC30630 zone)

EMBL: CP002049.PE501

CP002049.PE501       Location/Qualifiers
FT   CDS_pept        complement(558533..560299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0507"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /note="COGs: COG0147 Anthranilate/para-aminobenzoate
FT                   synthase component I;
FT                   InterProIPR019999:IPR015890:IPR001544:IPR005801:IPR 005802;
FT                   KEGG: hau:Haur_2989 para-aminobenzoate synthase, subunit I;
FT                   PFAM: Chorismate binding-like; aminotransferase class IV;
FT                   SPTR: A9B3Q5 Para-aminobenzoate synthase, subunit I;
FT                   TIGRFAM: para-aminobenzoate synthase, subunit I; manually
FT                   curated; PFAM: Aminotransferase class IV; chorismate
FT                   binding enzyme; TIGRFAM: aminodeoxychorismate synthase,
FT                   component I, bacterial clade"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13644"
FT                   /db_xref="GOA:D7CSB2"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7CSB2"
FT                   /protein_id="ADI13644.1"
FT                   /translation="MLVFDFSPGPRRVFGRPLEVIRADRLGEVAGAFAAVQRAVSGGLY
FT                   AAGFVAYEAAPAFDEALRTHPPGPLPLVWFGLYEAPTGSAPLTARPPSRMGGWALDTSP
FT                   EAYARAVAAIQGAIADGVTYQANYTVRLRGRVREPSSENLFALYEALRRVHAPPYASYL
FT                   ELGEAHLLSLSPELFFSVRGTRVTARPMKGTAARGRWLEEDEAQQRALLASPKERAENV
FT                   MIVDLLRNDLGKLARPGGVRVPALLSLETYPTFHTLTSTVTADLPERPTLWALFRALFP
FT                   CGSVTGAPKVSTMQLLRRLETTPRGVYCGAIGFVTPHGEMRFSVPIRTLVVTPDGRAEY
FT                   GVGSGVTYDARAEAEYEELATKAAAITRPRPEVELLETLLWDGARYTLLARHLRRMETS
FT                   ARFFGVAFDARALQRALMAHAEAFRGERRRVRARLSHSGVAVESTPYAPPPERPPVALA
FT                   RTPIDPRDPFLYHKTTHREVYARHRRAFPDAFDVLLWNGRGELTEFTIGNLVVERRGER
FT                   LTPPREAGLLAGTFRAELLEAGEITERPLFKHDLLDASRVWLVNSVHGWVEVQLQNAFR
FT                   RSFGAAEAGAPP"
     gtgctggtgt tcgacttctc ccctggaccg cggcgggtct ttgggcgccc cctggaggtc        60
     atccgtgcgg accgcctcgg cgaggtcgcg ggggcgttcg cggccgtgca gcgggccgtg       120
     agcgggggac tctacgcggc agggttcgtg gcctacgaag cggcgcccgc tttcgacgag       180
     gcgctcagga cgcacccccc cggcccgctg ccgctcgtct ggttcggcct ctacgaggcg       240
     ccgacgggga gcgccccctt gacagcgcgc ccgccgagcc gaatgggcgg ttgggcgctc       300
     gacacctcgc ccgaagcgta cgcccgcgcg gtcgccgcca tccaaggggc gatcgccgac       360
     ggcgtgacct accaggccaa ctacacggtg cggctgcgcg ggcgggtgcg cgagccttcc       420
     tccgagaacc tcttcgcgct ctacgaagcg ctccggcggg tgcacgcacc accctacgcg       480
     agctacctcg agctcggcga ggcgcacctc ctctcgctct cccccgagct gttttttagc       540
     gtgcgcggaa cgcgcgtcac ggcgcggccg atgaagggca ctgcggcgcg cgggcgctgg       600
     ttggaggagg acgaggcgca gcagcgggcg cttctggcga gccccaaaga gcgcgccgaa       660
     aacgtgatga tcgtcgacct tttgcgcaac gacctcggca agctcgcgcg ccccggcggg       720
     gtgcgggtgc cagcgctttt aagcctcgag acctacccga cgtttcacac cctgacctcg       780
     acggttaccg ccgacctccc ggagcggccg acgctgtggg cgctcttccg ggcgctcttc       840
     ccctgcgggt cggtcacggg cgcgcccaaa gtcagcacca tgcagctcct gcgccgcctt       900
     gaaactaccc ctcgcggcgt ctactgcggc gcgatcggtt tcgtcacccc ccacggcgag       960
     atgcgcttta gcgtccccat ccgcacgctc gtcgttaccc ccgacgggcg cgccgagtac      1020
     ggcgtcggga gcggcgtcac ctacgacgcg cgggcggagg ccgagtacga ggagctggca      1080
     accaaagccg ccgccatcac ccgcccgcgc cccgaggtcg agctgctcga gaccctcctc      1140
     tgggacgggg cgcgctacac cctgctggcg cggcacctac ggcgcatgga gacctcggcg      1200
     cgctttttcg gcgtcgcgtt cgacgcgcgt gccctgcagc gcgccctcat ggcgcacgcc      1260
     gaggcctttc gcggtgagcg gcggcgcgtg cgggcgcgcc tctcgcacag cggcgtcgcg      1320
     gtcgagagca ccccctacgc gcccccgccg gaacgaccac ccgtcgccct cgcccgcacc      1380
     cccatcgacc cccgcgaccc cttcctctac cacaagacca cccaccggga ggtctacgca      1440
     cgtcaccgcc gcgcctttcc ggacgccttc gacgtgctct tgtggaacgg gcgcggcgag      1500
     ctcaccgagt tcaccatcgg caacctcgtc gtcgaacgcc gtggcgagcg cctcaccccg      1560
     ccgcgcgagg ccggcctgct cgccgggact tttcgcgccg agctgctcga ggcgggtgag      1620
     atcaccgagc gccctctgtt taagcacgac ctcttagacg cctcccgcgt ctggctagtc      1680
     aacagcgtgc acggttgggt cgaggtgcag cttcaaaacg cctttagacg gtctttcggc      1740
     gcagcggagg cgggcgcacc gccttga                                          1767
//

If you have problems or comments...

PBIL Back to PBIL home page