(data stored in ACNUC30630 zone)

EMBL: CP002049.PE56

CP002049.PE56        Location/Qualifiers
FT   CDS_pept        61421..62080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0056"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tro:trd_A0513 hypothetical protein; SPTR:
FT                   B9L3Z9 Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13199"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX75"
FT                   /protein_id="ADI13199.1"
FT                   /translation="MTLTAAQTLRRSALITLYLLALSLLPWAAAQLTVRYDGGPTGGFE
FT                   AFIVLQEAIAFELDGEAAGLYVVARRGDEVLLDTSVALEPVVSGRVAVGMITVPIFGMC
FT                   EGGPTLFIQVQTTKVEGSGSRSLTGCLETSGGYLERTVASGPGTFVATAPLDRWIALQA
FT                   LLTPEAYTDTVLGEDAVTFFAFFGREDPARLGAPYPPLPDVRTFDELQALALFPAP"
     gtgaccttga cagccgccca aaccctacgc cgctccgcgt tgatcacgct ctatctcctc        60
     gcactctccc tgctgccgtg ggccgcagcg cagctcaccg ttcgttacga cggcgggcct       120
     acgggcggtt tcgaagcgtt cattgtgctg caagaggcga tcgcgtttga actagacggg       180
     gaggccgccg gcctctacgt cgtcgcgcgg cgcggcgacg aggtgctgct cgacaccagc       240
     gtcgcgctcg agccggtcgt ctcggggcgc gtcgccgtgg ggatgatcac ggtgcccatc       300
     ttcggtatgt gcgaaggggg gccgacgctc tttatccagg tgcagaccac caaagtggag       360
     ggttcgggca gccgctcgct caccggctgt ttggagacgt ccggcgggta cctcgagcgg       420
     accgtcgcga gcggccccgg gacctttgtg gcgaccgcgc cgctcgaccg ctggatcgcc       480
     ctgcaggcgc tgctgacgcc agaggcctac accgacaccg tcctcggcga ggacgccgtg       540
     acgtttttcg cctttttcgg tcgcgaagac ccggcgcgtc tgggggcgcc ctacccgccg       600
     ctgcccgacg tgaggacgtt cgacgagctg caggctctgg cgctcttccc cgccccttag       660
//

If you have problems or comments...

PBIL Back to PBIL home page