(data stored in ACNUC30630 zone)

EMBL: CP002049.PE59

CP002049.PE59        Location/Qualifiers
FT   CDS_pept        64594..65226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0059"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="InterPro IPR000182:IPR016181; KEGG: rca:Rcas_0119
FT                   hypothetical protein; PFAM: GCN5-related
FT                   N-acetyltransferase; SPTR: A7NFM9 Putative uncharacterized
FT                   protein; PFAM: Acetyltransferase (GNAT) family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13202"
FT                   /db_xref="GOA:D7CX78"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX78"
FT                   /protein_id="ADI13202.1"
FT                   /translation="MERDVLITTLRPEHAEGLEQLQIDCYPTLAPHERMRREHFLSHAR
FT                   LFPEGNFVALLGDRIVGLGSGFLTDFDLQHPDHTFQEIIAGGFYTHHDPQGAWYYGGDI
FT                   SVHPDVRGRGIGRRLYEARKEVVRRLGRRGIVAGGLLPGYRAYKGRLSVHDYVAKVVAG
FT                   ELTDPTLSFQLRNGFEVRGLLPGYLEDSASDNWATLIVWENPAWRPE"
     gtggagcgag acgtcctcat caccacctta agacccgagc acgccgaggg gctcgagcag        60
     ctccagatcg actgctaccc caccctggcg ccgcacgaac ggatgcgacg cgagcacttt       120
     ttaagccacg cgcggctctt ccccgagggc aacttcgtag cgctcttggg cgaccggatc       180
     gtcgggctcg gttcggggtt tctcaccgac ttcgacctgc agcaccccga ccacaccttt       240
     caggagatca tcgccggggg cttctacacc caccacgacc cgcagggtgc gtggtactac       300
     ggcggcgaca tcagcgtgca cccggacgtg cgcggccgcg gcatcgggcg ccggctctac       360
     gaggcgcgca aggaggtcgt gcggcgcctc gggcggcgcg gcatcgtggc cgggggattg       420
     ctgcccggtt accgcgccta caaggggcgg ctgagcgtgc acgactatgt ggcgaaggtc       480
     gtggcgggcg agctcaccga cccgaccttg agctttcagc tccgcaacgg cttcgaggtg       540
     cgggggctgc tgccgggcta cctcgaggac agcgcgtcgg acaactgggc gaccttgatc       600
     gtctgggaga accccgcgtg gcggcccgag tag                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page