(data stored in ACNUC30630 zone)

EMBL: CP002049.PE72

CP002049.PE72        Location/Qualifiers
FT   CDS_pept        complement(74651..75970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0072"
FT                   /product="signal recognition particle protein"
FT                   /note="COGs: COG0541 Signal recognition particle GTPase;
FT                   InterProIPR004780:IPR013822:IPR000897:IPR004125:IPR 003593;
FT                   KEGG: dge:Dgeo_1440 signal recognition particle protein;
FT                   PFAM: GTP-binding signal recognition particle SRP54 G-
FT                   domain; GTP-binding signal recognition particle SRP54
FT                   helical bundle; Signal peptide binding (SRP54) M- domain
FT                   protein; SMART: AAA ATPase; SPTR: C1XNM7 Signal recognition
FT                   particle subunit FFH/SRP54 (Srp54); TIGRFAM: signal
FT                   recognition particle protein; PFAM: SRP54-type protein,
FT                   GTPase domain; SRP54-type protein, helical bundle domain;
FT                   Signal peptide binding domain; TIGRFAM: signal recognition
FT                   particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13215"
FT                   /db_xref="GOA:D7CX91"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX91"
FT                   /protein_id="ADI13215.1"
FT                   /translation="MFESLGDRLQGVFDSLRGRGRLTEDEVRAALREVRVALLEADVSL
FT                   EVARDFTKRVQEKAVGSETLMSLQPDQRVIAIVHDELVELLGGKTAQPSLKNDANVWLL
FT                   LGLQGAGKTTTAGKLAYKYKAQGRRPLLVAADTQRPAAREQLRVLGKQIGVPVLEVEDH
FT                   ETPARTRARLQEVLRTTYHDLVIVDTAGRLQIDEALMDAVAELKAELSPSETMLVIDAM
FT                   TGQQSLPVAKTFDERVGVTGLIMTKLDGDARGGAALSARHVTGKPIYFAGMSEKIDGLE
FT                   AFHPDRIAGRILGMGDVLTLIEKAKALEGDDEADAAATLKDFSLQDMLTQMQKIKRMGS
FT                   FTEILKMIPGASRLLPPGAEIDEREIARIEAIISSMTERERRQPKLLNASRRKRIAAGS
FT                   GTSVQDVNRLMKNYEQMKKVMKQLGRRPPGRGLPGRGLGR"
     atgtttgaaa gcttaggcga cagattacag ggagtgttcg attccctacg cgggcgcggc        60
     aggttgaccg aagacgaggt gcgcgcggcg ctgcgcgagg tgcgcgtcgc cctcctcgag       120
     gccgacgtct cgttggaggt cgcccgcgac tttaccaaac gcgtgcagga aaaagcggtc       180
     ggctccgaga cgctcatgtc gctgcaaccc gatcagcggg tgatcgccat cgtgcacgac       240
     gaactcgtcg agctgctggg gggcaaaacc gcgcaaccca gccttaaaaa cgacgccaac       300
     gtgtggctgc tcctcggctt gcaaggggcc gggaagacga ccaccgcggg caaactcgcc       360
     tacaagtaca aagcgcaggg gcgcagaccg ctgctggtcg ctgccgacac ccaacgcccc       420
     gcggcgcgcg agcagctgcg cgtgctcggc aagcagatcg gcgtccccgt cttggaggtc       480
     gaggaccacg agacgcccgc acgtacccgg gcgcggttgc aggaggtgtt gcgcaccacc       540
     taccacgacc tcgtgatcgt cgacacggcg gggcggctgc agatcgacga agccctgatg       600
     gacgccgtcg ccgagcttaa agcggagctc tcacccagcg agacgatgct cgtcatcgac       660
     gccatgaccg gccagcagtc gctccccgtg gccaagacct tcgacgagcg cgtcggcgtc       720
     accggtttga tcatgaccaa gctcgacggg gacgcgcgtg gcggggcggc gctgtcggcg       780
     cggcacgtca ccggcaaacc gatctacttc gccgggatga gcgaaaagat cgacggtctg       840
     gaggcgtttc accccgaccg catcgccggc cgcatcctcg gcatgggcga cgtgctgacg       900
     ctgatcgaaa aggccaaggc cctagagggt gacgacgaag cggacgcagc cgcgaccctc       960
     aaagacttct cgctgcagga catgctcacg cagatgcaga agatcaagcg gatggggtcg      1020
     tttaccgaga tcctgaagat gatccccggc gccagccggc tcctcccccc cggcgcggag      1080
     atcgacgaac gcgaaatcgc ccgcatcgag gcgatcatct cctcgatgac cgagcgcgag      1140
     cgccgccaac cgaagctgct caacgccagc cgccgcaaac gcatcgcggc gggctcgggc      1200
     accagcgtgc aagacgtcaa ccgcttgatg aaaaactacg agcagatgaa aaaggtcatg      1260
     aagcagctcg gtcggcgccc gccggggcgc gggctgccgg gccgcgggct cgggcgctaa      1320
//

If you have problems or comments...

PBIL Back to PBIL home page