(data stored in ACNUC30630 zone)

EMBL: CP002049.PE78

CP002049.PE78        Location/Qualifiers
FT   CDS_pept        complement(91876..94434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0078"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="COGs: COG1404 Subtilisin-like serine protease;
FT                   InterPro IPR000209:IPR007280; KEGG: dra:DR_A0283 serine
FT                   protease; PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; peptidase domain protein; SPTR: Q9RYM8 Probable
FT                   subtilase-type serine protease DR_A0283; PFAM: Bacterial
FT                   pre-peptidase C-terminal domain; Subtilase family"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13221"
FT                   /db_xref="GOA:D7CX97"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7CX97"
FT                   /protein_id="ADI13221.1"
FT                   /translation="MTRSVIGTLLLALALAACTLNPPAPSVRNPTPSYTIDRVGDQSFI
FT                   RGQLIVGYREGASPEAIARRLGATVQQDWPLLRAALLQLPPRLSVPKAKVSAERLEGVR
FT                   YAEPNLVHFRPEPARGVATTALSPTQVSVSDPEFGRQWMHRQMNSLGAWSQGVSGSGIR
FT                   IGIHDDFIDHRHPDLVDNMFYPGFDGFAASNPEVPIEAALITPETPHDGVGFHGTSVAG
FT                   TAAAVGNDLGGRGTAYGASIVPLAINEPEQGGLVLSAIVNSAIFAVLGPDFAFGGDDRA
FT                   PGTDPETGPYVHIVNMSWGGAFYNQLIKDTMDLMLASGIVLVTSAGNTPTEGPSFPSWN
FT                   PGLINVAATTARGTRTNFSNRGLHLDLAAPGENIWTTTTRGCIFATPDGASCSEEEPEV
FT                   AYTYINGTSFSSPAVAGTAALILEAGAERDAEGNITALPSAAQVQRVLTETAFQPSGYE
FT                   RSALGAGIADSAAAVARVLSGDPIPDGGSLLAEVVWAGNPDIRVPQVGLTLIPEDGDAA
FT                   VKYTQTSDGTLLTPLGIGLFQQMPSGRYTLQASGPYRSVHGIEVGTAQTSVEIRPGEAT
FT                   AVRLALELSPFEDPFEPNNTLETAAELEEVGVTVRASLYDPEAASDVDVYSIPVTAGSV
FT                   YRASLKTASGNVAPALTVYDASGTPIAQSGSTQAFTLNPFVEFEAPEDGLAYIEVTETS
FT                   GLEGSNSPFNLYDLDIARYIGEEEEPNGSAVVIGTSIQNIDFTDAQRIPLGSALDAELT
FT                   EGDTDIFQVEVPAGATVVGDIVTAVDGQPDTLLGVYNEAGQQVAFNDDYNGRASRVLYA
FT                   SQTGGLYYFVVAPWDAINPQNATTGPYNFSVTRHLNPPTE"
     gtgacgcgct ctgttatcgg cacgctgctc ctcgccctag cgctcgccgc gtgcaccctc        60
     aacccgcccg cccccagcgt ccgcaacccc acgccctcct acaccatcga ccgcgtcggc       120
     gaccagagct ttatccgcgg ccagctcatc gtcggctacc gcgagggcgc ctcccccgag       180
     gccatcgcgc gccggctcgg cgctaccgtg cagcaagact ggccactcct gcgcgccgcg       240
     ctcctgcagc tgccgccgcg cctcagcgtc cccaaagcca aggtcagcgc cgaacggctc       300
     gagggggtgc gctacgccga acccaacctc gtgcactttc ggcccgaacc ggctcggggc       360
     gtcgcgacga ccgccctttc gcccacccag gtcagcgtct ccgaccccga gtttggccgg       420
     cagtggatgc accggcagat gaattcgctc ggggcgtgga gccaaggggt ctccggcagc       480
     ggcatccgca tcggcatcca cgacgacttt atcgaccacc gccaccccga cttggtcgac       540
     aacatgttct acccgggctt cgacggtttc gccgcctcga accccgaggt tcccatcgaa       600
     gccgctctca ttacccccga aacgccgcac gacggcgtcg gctttcacgg cacgtcggtc       660
     gcggggaccg cggcggcggt cggcaacgac ctcggcgggc gcggtaccgc ctacggcgcc       720
     agcatcgtcc ccttggcgat caacgaaccc gagcagggcg gtctggtgct gagcgccatc       780
     gtcaactcgg cgatctttgc agtgttgggc cccgacttcg ccttcggcgg cgacgaccgc       840
     gcccccggca ccgaccccga gacggggccg tacgtccaca tcgtcaacat gtcgtggggc       900
     ggcgccttct acaaccaact catcaaggac acaatggacc tgatgctcgc ctcggggatc       960
     gtgctggtga cctcggcggg caatacgccg accgaagggc cttcgttccc ctcgtggaac      1020
     cccgggctca tcaacgtcgc ggcgacgacc gcgcggggga cgcgtacgaa cttctccaac      1080
     cgcgggttgc acctcgacct cgccgccccg ggggagaaca tctggacgac caccacgcgg      1140
     ggctgcatct tcgcgacccc cgacggcgcc tcgtgcagcg aggaggagcc ggaggtcgcc      1200
     tacacctaca tcaacggcac ctcgttctcg agcccagcgg tcgccggcac cgcagcgctc      1260
     atcctcgaag cgggcgccga acgcgacgcc gagggcaaca tcaccgccct cccgagcgcc      1320
     gctcaggtgc agcgcgtttt gactgaaacg gccttccaac cgagcggtta cgagcgcagc      1380
     gcgctgggcg cgggcatcgc cgactcggcg gcggccgtgg cccgggtgct ctccggcgac      1440
     cccatccccg acggcggttc cctcctcgcc gaggtcgtgt gggcgggtaa ccccgacatc      1500
     cgcgtcccgc aggttgggct cacgctcatc ccggaagacg gggacgccgc ggtgaagtac      1560
     acccaaacgt ccgacggcac cctgctcacc cccctgggca tcggcctctt tcagcagatg      1620
     ccgtcgggtc gctacaccct tcaggccagc ggaccctacc ggtcggtcca cggcatcgag      1680
     gtcggaaccg cgcagacgag cgtagagatc cgccccggcg aagccacggc ggtgcggttg      1740
     gcgctcgagc tgagcccctt cgaagacccc ttcgaaccca acaacaccct ggagacggct      1800
     gccgagctcg aggaggtcgg cgtcaccgtg cgcgcgagcc tctacgaccc ggaagctgcg      1860
     agcgacgtcg acgtctacag catccccgtc acggccggca gcgtctaccg cgcgagcctg      1920
     aaaaccgcct cggggaacgt cgccccggcg ctcacggtct acgacgcctc cggcacgccg      1980
     atcgcccaga gcggcagcac ccaggccttt accctcaacc ccttcgtcga gttcgaagcg      2040
     cccgaagacg gcctcgccta catcgaggtg acggagacga gcgggctcga ggggagcaac      2100
     agccccttta acctctatga cctcgacatc gcgcgctaca tcggcgagga ggaagagccc      2160
     aacggctcgg cggtggtcat cggcacctcg attcagaaca tcgacttcac cgacgcccag      2220
     aggatcccct tgggcagcgc cctcgacgcc gagctcaccg aaggcgacac cgacatcttc      2280
     caggtggagg tgcccgctgg cgcgacggtc gtcggggaca tcgtgaccgc tgtcgacggg      2340
     cagcccgaca ccctgttggg cgtctacaac gaggcgggtc aacaggtcgc ctttaacgac      2400
     gactacaacg ggcgcgcctc gagggtcctt tatgcctcac agacgggtgg cctctactac      2460
     ttcgtcgtcg ccccctggga cgcgatcaac ccgcaaaacg ccaccaccgg cccctacaac      2520
     ttcagcgtta cacgccacct gaacccacct accgagtaa                             2559
//

If you have problems or comments...

PBIL Back to PBIL home page