(data stored in ACNUC30630 zone)

EMBL: CP002049.PE81

CP002049.PE81        Location/Qualifiers
FT   CDS_pept        complement(98907..99905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0081"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="COGs: COG0598 Mg2+ and Co2+ transporter; InterPro
FT                   IPR002523; KEGG: dge:Dgeo_0150 Mg2+ transporter protein,
FT                   CorA-like protein; PFAM: Mg2 transporter protein CorA
FT                   family protein; SPTR: Q1J231 Mg2+ transporter protein,
FT                   CorA-like protein; PFAM: CorA-like Mg2+ transporter
FT                   protein; TIGRFAM: magnesium Mg(2+) and cobalt Co(2+)
FT                   transport protein (corA)"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13224"
FT                   /db_xref="GOA:D7CXA0"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="InterPro:IPR004488"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXA0"
FT                   /protein_id="ADI13224.1"
FT                   /translation="MADPAPLTPHPEPALAPHPNIRVKDLSACADAPWCGQRHGVWIDL
FT                   ENPTREQVAALQESFSFNPLALEDALATEHWSRFERYPEHLFLIFRTLAEPGALTERTE
FT                   EIDLFWFPQQRALITFRHEPVGYLEAVWQELDRFAERTPVEVLYTLLQRGTDTFFTFLD
FT                   ELEDRTDALERRAFEDHGGGRRESPLYQEVFTLRRTMIAARRHASSARENVAQLSRHAS
FT                   ELSPEGALYLRDVADHLARVYDGLDTARDVLTGLLEVYLNIENQRLNEVMRTLTTVSTV
FT                   FLPLTFLAGVWGMNFQYEPEFAWRYGYLFAWATFVTIGGSLLVFFKRKGWW"
     atggcagacc ccgcgcccct cacgccccac cccgagcccg ccctagcgcc gcaccccaac        60
     atccgcgtca aggacctttc agcgtgcgcc gacgcgccct ggtgcgggca acgtcacggc       120
     gtctggatcg atctcgagaa ccccacccgc gagcaggtcg cggcgctcca ggagagcttc       180
     tcgtttaacc ccctcgccct cgaggacgcc ctcgccaccg agcactggag ccgcttcgag       240
     cgctaccccg agcacctctt cctgatcttc cgcaccctcg ccgaacccgg agcgctcacc       300
     gaacgtaccg aggagatcga cctcttctgg tttccccagc agcgcgcgct catcaccttc       360
     cgccacgaac cggtcggcta cctcgaggcc gtctggcagg agctcgaccg cttcgccgag       420
     cgcacccccg tcgaggtgct ctacaccctg ctgcagcgcg gcacggacac cttcttcacc       480
     tttttggacg agctcgagga ccgcaccgac gcgctcgagc gccgcgcgtt tgaggaccac       540
     ggcggaggac gacgcgaaag ccccctctac caggaggtct ttacgctgcg gcgcacgatg       600
     atcgccgccc gtcgccacgc ctctagcgcc cgcgaaaacg tcgcgcagct ctcccggcac       660
     gcgagcgagc tctcccccga aggggcgctc tatctgcgcg acgtcgccga tcacctggcc       720
     agggtctacg acggcctcga caccgcgcgc gacgtgctca cggggttgct cgaggtctac       780
     ctcaacatcg aaaaccaacg cctcaacgag gtcatgcgca cgctgacgac cgtctcgacc       840
     gtcttcttgc cgctgacctt tttggcaggg gtgtggggga tgaactttca gtacgaaccc       900
     gagttcgcct ggcgctacgg ctacctcttc gcttgggcca cctttgtgac catcgggggg       960
     tcgctgctcg tgttctttaa gcgcaagggg tggtggtga                              999
//

If you have problems or comments...

PBIL Back to PBIL home page