(data stored in ACNUC30630 zone)

EMBL: CP002049.PE9

CP002049.PE9         Location/Qualifiers
FT   CDS_pept        8116..8838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0009"
FT                   /product="SNARE associated Golgi protein-like protein"
FT                   /note="COGs: COG0398 conserved hypothetical protein;
FT                   InterPro IPR015414; KEGG: hau:Haur_1237 SNARE associated
FT                   Golgi protein; PFAM: SNARE associated Golgi protein; SPTR:
FT                   A9B1K0 SNARE associated Golgi protein; PFAM: SNARE
FT                   associated Golgi protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13152"
FT                   /db_xref="GOA:D7CWR1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:D7CWR1"
FT                   /protein_id="ADI13152.1"
FT                   /translation="MPEPKRTERTRRRRSAGEGGQRRTLHTLVVVALWLGGLLALWLFA
FT                   RAQGQTPGGLLQELLEALRVHPLAPFLLFGLYLVRPLFLLPVTLLTLTAGLLFGAFWGF
FT                   WYAAAATLASATVAYIVGRFFAQDLPGRFGQGVSTRLQRFPFETVLLCRFLLLPGDLVN
FT                   YLAGFLRVRLGAFLLATLIGGAPGLLVGVLAGASLEGLPGEVRLNAWYLVASGVLLGLS
FT                   LGVSRWLRRRNPLGRNPL"
     atgccggagc cgaagcgcac cgagagaact cgtcggcggc gcagcgcggg ggaggggggg        60
     caacgccgaa ccctgcacac cctcgtcgtg gtggcgctgt ggctcggagg gctcctcgcg       120
     ctgtggctgt tcgctagagc ccaggggcag accccggggg ggctcttgca ggagcttctc       180
     gaggcgctcc gcgtgcaccc gctggcgccc tttttgctct tcgggctcta cctcgtccgg       240
     ccgctttttc tcctccccgt gaccctactg accctgaccg ccgggctgct cttcggcgcg       300
     ttctgggggt tttggtacgc cgctgccgcc acgctcgcct cggcgacggt ggcctacatc       360
     gtcggtcgct ttttcgccca ggacctcccc gggcgcttcg ggcagggtgt ctcgacccgg       420
     cttcagcggt ttcccttcga gacggtgttg ctgtgccgct ttctgctcct cccgggcgac       480
     ttggtcaact acctcgccgg ctttttgcgg gtgcgtctgg gcgctttttt gctggcgacc       540
     cttatcggtg gggcgccggg gctcctcgtc ggcgtcctcg ccggcgcttc gctcgagggg       600
     ttgccgggtg aggtgcgcct gaacgcgtgg tacctcgtcg cctcgggggt gctcctcggc       660
     ctcagcctag gggtctctag gtggttgcgg cgccgcaacc cgctcgggcg caacccgctc       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page