(data stored in ACNUC30630 zone)

EMBL: CP002049.PE94

CP002049.PE94        Location/Qualifiers
FT   CDS_pept        110174..110473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Trad_0095"
FT                   /product="putative NAD(P) transhydrogenase subunit alpha"
FT                   /note="COGs: COG3288 NAD/NADP transhydrogenase alpha
FT                   subunit; KEGG: ote:Oter_4579 putative NAD(P)
FT                   transhydrogenase subunit alpha; SPTR: B5JJ24 Putative
FT                   uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:Trad_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ADI13237"
FT                   /db_xref="GOA:D7CXB3"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D7CXB3"
FT                   /protein_id="ADI13237.1"
FT                   /translation="MNPPPDTHTLLLLLFIFVLALFLGRELITKVPSQLHTPLMSGSNA
FT                   ISGITIVGAILAAGSEGAFSTALGVVALVAATINVVGGYLVTDRMLGMFKKGGR"
     atgaacccac cccctgacac ccacaccctc ctgctgctgc tctttatctt cgtgttggcc        60
     ctttttctcg gccgcgaact catcaccaag gtgccgtcgc agctccacac cccgctgatg       120
     tcggggtcga acgcgatctc ggggatcacc atcgtcgggg cgattctcgc ggcggggagc       180
     gagggggcct ttagcacggc gctcggggtc gtcgccctgg tcgccgcgac catcaacgtc       240
     gtcggcggct atctggtcac cgaccggatg ctcggcatgt tcaaaaaggg cgggcgctag       300
//

If you have problems or comments...

PBIL Back to PBIL home page