(data stored in SCRATCH zone)

EMBL: CP002059.PE1

CP002059.PE1         Location/Qualifiers
FT   CDS_pept        2007..2231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0002"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mitochondrial protein Fmp25, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62669"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62669.1"
FT                   /translation="MPFFTAYVSFYAPLDFFSPQFLPVALYGAECGLYATFITDIKLSD
FT                   SKNNSLGEQGDFVSWGKDCAFSYSNYRYR"
     atgccttttt tcactgcata tgtttctttt tatgctccct tagatttttt ctctccgcaa        60
     tttctccctg tggcacttta tggtgccgaa tgtgggttgt atgctacgtt tatcaccgat       120
     ataaaattga gtgatagtaa aaataactct ttaggggagc aaggcgattt tgtgagctgg       180
     ggtaaagact gtgcttttag ctacagtaac tatagatatc gctaa                       225
//

If you have problems or comments...

PBIL Back to PBIL home page