(data stored in SCRATCH zone)

EMBL: CP002059.PE105

CP002059.PE105       Location/Qualifiers
FT   CDS_pept        117822..118445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: npu:Npun_F1872 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62773"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVG5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F1872"
FT                   /protein_id="ADI62773.1"
FT                   /translation="MTTDLTSSITPDFHSILSQTAIAYREGSKPPKADVVVNALLQAEK
FT                   YAKQQRLNYPFDSLMGKWRLCFVTGTKKIRKRGGIVLGKGFYVPRFTSVHISFSIITEQ
FT                   VLDRGEIGNQVQLGSILLNLNGPAKYLGNKNLLAFDFTQMQISFSDRVVYNRQIRSGKT
FT                   QTLDFDNQPIAKLPFFAFFLLTEDFIAARGRGGGLAIWIKANPN"
     atgacgactg atttaacatc tagcattacc cctgattttc atagcattct ctcccaaact        60
     gcgattgcat atcgagaagg aagcaaacct cctaaggctg atgtagtggt aaatgcttta       120
     ctacaagcag aaaaatatgc caagcaacaa cgactaaatt atccttttga ctctctaatg       180
     ggtaaatggc ggctgtgctt tgttactggt actaaaaaaa tcaggaagcg gggaggaatt       240
     gttttaggta agggctttta tgtgcctaga tttacatcag tacatatttc ctttagtatc       300
     attacagaac aagttttaga tagaggtgaa attggtaatc aggtacaatt aggctcgata       360
     ttattaaact tgaatggccc tgcaaaatat ttaggtaaca agaatttatt agcatttgat       420
     tttacccaga tgcaaatcag tttttctgat cgcgttgttt acaaccgtca aatacgttct       480
     ggtaaaactc aaactttaga ttttgacaat caacctatag ctaaattacc attttttgct       540
     ttctttttac taactgaaga ttttatagcc gcccgtggtc gtggtggagg tttggcaatt       600
     tggattaaag caaaccctaa ttag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page