(data stored in SCRATCH zone)

EMBL: CP002059.PE11

CP002059.PE11        Location/Qualifiers
FT   CDS_pept        16966..17157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:asl4482 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62679"
FT                   /db_xref="InterPro:IPR021291"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVM8"
FT                   /inference="similar to AA sequence:KEGG:asl4482"
FT                   /protein_id="ADI62679.1"
FT                   /translation="MEIGQKVKVIRIRDRVSAPITKKLGQFGMIEGYKVTDGGGFGVVV
FT                   KFDDNSSTWFFEDEIKAI"
     atggaaatcg gacaaaaggt taaagtgatt cgtatccgcg atcgcgtatc agcccctatc        60
     accaaaaagt taggccaatt tggcatgatc gaaggctaca aagttaccga tggtggaggt       120
     ttcggtgtag tcgtcaagtt tgacgataac tcctccactt ggttctttga ggatgaaatt       180
     aaagccatat ag                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page