(data stored in SCRATCH zone)

EMBL: CP002059.PE113

CP002059.PE113       Location/Qualifiers
FT   CDS_pept        133259..133978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0140"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /note="KEGG: ava:Ava_1750 Crp/FNR family transcriptional
FT                   regulator; PFAM: regulatory protein Crp; SMART: regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62781"
FT                   /db_xref="GOA:D7DVF0"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF0"
FT                   /inference="protein motif:PFAM:PF00325"
FT                   /protein_id="ADI62781.1"
FT                   /translation="MQSQSSFSEASRPFLTWQRILDWAQEHYRCRTFSKDERIPARPGL
FT                   LYLVQRGAIRMVGTAQVSATASQLTSRRINRTPEEAFLGFVGAGQPFEIVAQSPFTLQS
FT                   YAHVDQTAVLWMYWHDLDNWPHFRREVMDAFRYQHQRKLLWLSALGQRRTIDRLLGFLT
FT                   LLIEEYGEPAMSETDPDVIRGYCLPFPLTHAQIGSAIGSTRVTVTRLMGKLRQRGLILT
FT                   QGDNLICLPAESINRTN"
     atgcaatctc aatcctcctt ttccgaagca tcacggcctt ttctaacttg gcaacgaatt        60
     cttgattggg ctcaagaaca ctaccgctgc cgcaccttca gcaaagatga gcgcattccc       120
     gccagacctg gcttgctcta tttagtccaa aggggtgcaa tccgcatggt aggaacagcc       180
     caagttagtg ccactgccag ccagttaaca tctcgacgca tcaatagaac cccagaagaa       240
     gccttcttag gttttgtggg agcaggacaa ccttttgaaa ttgtggctca gtcaccattc       300
     actctccagt cttatgccca cgttgaccaa actgcggtgt tatggatgta ctggcatgat       360
     ttagataact ggcctcactt ccgtcgtgaa gtaatggatg cctttagata tcaacaccaa       420
     cgcaagctgt tatggctcag tgcattggga cagcgacgca ccattgacag actactagga       480
     ttcctcacat tgctgattga ggaatatgga gagccagcaa tgagcgaaac tgatcccgat       540
     gtaattcgtg gctattgtct gcccttccct ctcactcatg cccaaattgg tagcgccatt       600
     ggttcaactc gtgtcacagt tacccgttta atgggtaaat tgcgtcaacg tggactaatc       660
     ctcacccaag gggataattt gatttgcttg ccagcagagt caattaacag aaccaactaa       720
//

If you have problems or comments...

PBIL Back to PBIL home page