(data stored in SCRATCH zone)

EMBL: CP002059.PE114

CP002059.PE114       Location/Qualifiers
FT   CDS_pept        135674..135799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0142"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62782"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62782.1"
FT                   /translation="MPVLGLVIAHLLFATPHKIALLPLLSRFQFRLIDLQSALLF"
     atgcctgttt tgggtttagt gatcgcacac ttactttttg ccacacctca caaaatcgcc        60
     ttgctcccct tgctgtctag gtttcaattt agactcattg atctgcaatc tgctttattg       120
     ttttaa                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page