(data stored in SCRATCH zone)

EMBL: CP002059.PE117

CP002059.PE117       Location/Qualifiers
FT   CDS_pept        140615..140734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62785"
FT                   /db_xref="UniProtKB/TrEMBL:D7DVF5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62785.1"
FT                   /translation="MVVLSDPQNTLNITNFIKSLLFNQPQIDVEYLRIDVSKS"
     atggtagttt taagtgatcc ccaaaataca ctgaacataa ctaatttcat caaatccctg        60
     ctgttcaatc agccccaaat tgatgtagaa tatcttagaa tagatgtcag taaaagttaa       120
//

If you have problems or comments...

PBIL Back to PBIL home page