(data stored in SCRATCH zone)

EMBL: CP002059.PE132

CP002059.PE132       Location/Qualifiers
FT   CDS_pept        complement(156494..157777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0165"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   ava:Ava_1090 valine--pyruvate transaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62800"
FT                   /db_xref="GOA:D7DYH7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ADI62800.1"
FT                   /translation="MKPALTKIGAQMSNLTGVRAIMKDINETLRANEGQELYNLSAGNP
FT                   LILPEVEQLWRDCTADLLASPEYGEVVCRYGSSQGYAPFISVMVKDFNQRYGLNLTERN
FT                   ILVTAGSQTIYFYAANAYGGYTNDGDLKQIVLPLSPDYTGYGGVGLCPEALIAYKPTLD
FT                   IDSANHRFKYRPDFSQLSITQETGCMIFSRPCNPTGNVLTNDEVEKIAALAAPYHVPVL
FT                   IDSAYAPPFPALNFTEMTPVFGENILHCMSLSKAGLPGERIGIAIGDENLLQALECFQT
FT                   NAGIHSSRYGQAIAARAIESGALANIAESVIRPFYRHKFNVLESTLEVAIPNNIPWFLH
FT                   RGEGAIFGWLWLEDLPMTDWEFYQELKKVGVIVVPGSSFFPGLKEEWEHKHQCLRISLT
FT                   GSDEEITIGMQHLAKVAEQVYQRAAVSV"
     atgaaacctg cccttaccaa aattggcgct caaatgtcca acttaactgg cgtgagagca        60
     attatgaagg atattaatga aacacttaga gctaatgagg ggcaggagtt atataatttg       120
     agtgcgggaa acccgctgat tttaccagag gtagaacagt tatggcggga ttgcacagca       180
     gacttattag ctagtcctga gtatggtgaa gttgtttgtc gctacggttc atctcagggt       240
     tatgcacctt ttatttcggt aatggtcaaa gattttaacc agcgttatgg gttaaattta       300
     acagagcgca atatcttagt cactgctggt agtcagacta tttacttcta cgcggctaat       360
     gcttacggtg gatatactaa cgatggcgat ttaaaacaga ttgttctgcc tttaagtcca       420
     gattatactg gctatggtgg cgttggttta tgcccagaag ccttgattgc ttacaaaccc       480
     actcttgata ttgatagcgc caaccaccgc tttaaatatc gtcctgattt tagccaactt       540
     tcgattacac aagaaactgg ttgtatgatt ttctctcgcc cttgcaaccc tactggtaac       600
     gttttaacta atgacgaagt tgagaaaatc gccgctttag ctgcacccta tcatgtgcct       660
     gtgttgatag actcagctta tgcacctcct ttccctgcgt tgaattttac ggaaatgaca       720
     cctgtgtttg gtgagaatat tctgcattgt atgagtttat caaaggcagg attaccaggg       780
     gaaagaatcg gcatagctat tggtgatgaa aacctgctgc aagctttaga gtgtttccaa       840
     actaatgcag ggattcattc ttccaggtat ggtcaagcga tcgcagctag agcgatagaa       900
     tcaggtgcat tagccaatat tgctgaaagt gtgattcgtc ctttttatcg gcacaaattt       960
     aatgtgttag aaagcacatt agaagtagcg atacctaaca atataccttg gtttttacat      1020
     cgcggtgaag gggcgatctt tggttggttg tggttggaag atttaccaat gactgattgg      1080
     gaattttacc aggaattaaa gaaagtgggt gtgattgttg ttcctggtag tagtttcttc      1140
     cccggtctaa aagaggagtg ggaacacaag catcaatgtt tgcgtatcag tctgactggt      1200
     agtgatgaag aaattactat cggtatgcag catttagcta aggttgctga acaggtttac      1260
     caacgtgcgg ctgtcagtgt ttaa                                             1284
//

If you have problems or comments...

PBIL Back to PBIL home page