(data stored in SCRATCH zone)

EMBL: CP002059.PE133

CP002059.PE133       Location/Qualifiers
FT   CDS_pept        complement(159519..159974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0167"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ava:Ava_1441 transposase IS4"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62801"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYH8"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ADI62801.1"
FT                   /translation="MYGFDGCRKVKGRKGHTLVDSLGLVLKVVVSEANAPERILAAYAL
FT                   MELLEKPTELLEKVQVLWVDSGYDGDKFALAVWFLTQAHVEVIGPTEQEFKVLPQPWVV
FT                   ERTFGWFNQYHRLSKDYERLTQMREGAIYALMTRIMLLPLVSSTFTL"
     gtgtatggtt ttgacggatg tagaaaggta aaaggaagaa aggggcatac tttagttgat        60
     agcctgggac ttgtgttgaa agttgttgtt agtgaagcaa atgccccaga acgaatactt       120
     gctgcctatg cactaatgga actgctagag aaacccacag aattattgga aaaagtccaa       180
     gttttatggg ttgattccgg ttatgacggt gataaatttg cacttgcagt ttggttcctg       240
     actcaagctc atgttgaagt cataggacct actgagcaag aatttaaagt tttaccacaa       300
     ccctgggtag tagaaagaac atttgggtgg tttaaccaat atcatcgtct aagcaaggat       360
     tatgagcgtt taacacaaat gagggaaggg gctatatatg ctcttatgac tagaattatg       420
     ctacttcctc ttgtctcctc aacatttact ttataa                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page