(data stored in SCRATCH zone)

EMBL: CP002059.PE141

CP002059.PE141       Location/Qualifiers
FT   CDS_pept        complement(174445..174744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0181"
FT                   /product="ferredoxin (2Fe-2S)"
FT                   /note="KEGG: npu:Npun_F3727 ferredoxin (2Fe-2S); TIGRFAM:
FT                   ferredoxin [2Fe-2S]; PFAM: ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62809"
FT                   /db_xref="GOA:D7DYI6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR010241"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYI6"
FT                   /inference="protein motif:TFAM:TIGR02008"
FT                   /protein_id="ADI62809.1"
FT                   /translation="MATYKVTLINKAENFNETLEVADDVYILDAAEEAGFDLPYSCRAG
FT                   ACSTCAGKLVSGTVDQSDQSFLDDDQIEAGYVLTCVAYPSSDLVIETHKEEELY"
     atggctactt acaaagtcac attaatcaac aaagctgaga atttcaacga aacattagaa        60
     gttgccgatg atgtttatat cctagacgct gctgaagaag caggttttga cttgccttac       120
     tcttgccgtg ctggcgcttg ctcaacctgt gcaggtaaat tagtttctgg tacagttgat       180
     caatctgacc aatcattctt agacgatgat caaatcgaag ctggatatgt tttaacctgt       240
     gttgcatacc catcttcgga tttggtaatc gaaactcaca aagaagaaga actttactaa       300
//

If you have problems or comments...

PBIL Back to PBIL home page