(data stored in SCRATCH zone)

EMBL: CP002059.PE151

CP002059.PE151       Location/Qualifiers
FT   CDS_pept        complement(184523..184927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0193"
FT                   /product="photosystem II protein Psb27"
FT                   /note="TIGRFAM: photosystem II protein Psb27; KEGG:
FT                   ava:Ava_0578 photosystem II 11 kD protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62819"
FT                   /db_xref="GOA:D7DYJ6"
FT                   /db_xref="InterPro:IPR017488"
FT                   /db_xref="InterPro:IPR025585"
FT                   /db_xref="InterPro:IPR038450"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYJ6"
FT                   /inference="protein motif:TFAM:TIGR03044"
FT                   /protein_id="ADI62819.1"
FT                   /translation="MDMKHYWSRLLALVLVVTLGLMGCSGTPDGLSGDYRQDTLAVVNT
FT                   LRQAIEVSPEDPNKAALQAEARQKINDFSARYQRVNSVSGLNSFTTMRTALNSLAGHYS
FT                   SYPNRPIPEKLKNRLELEFDRVELALKRGG"
     atggatatga aacattattg gtcgcgtctg ctggcactgg ttttagttgt cacccttggc        60
     ttaatgggtt gttctggaac tcctgatggc ttgtcaggag attatcgtca agatacttta       120
     gctgtagtca acactttaag acaagccata gaagtatcac cagaagatcc aaataaagca       180
     gcactccaag cagaagcacg tcaaaaaatc aatgactttt ctgctcgtta tcagagagtt       240
     aattctgttt ctggtctgaa ttcttttaca actatgcgaa cagcactcaa ttccttagct       300
     ggacactata gttcttaccc caaccgtccc atccctgaaa aactgaaaaa ccgtctagag       360
     ttagagtttg atcgtgttga attagcccta aagcgtggtg gttaa                       405
//

If you have problems or comments...

PBIL Back to PBIL home page