(data stored in SCRATCH zone)

EMBL: CP002059.PE155

CP002059.PE155       Location/Qualifiers
FT   CDS_pept        189644..190885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0197"
FT                   /product="Dolichyl-phosphate beta-D-mannosyltransferase"
FT                   /EC_number="2.4.1.83"
FT                   /note="KEGG: ana:all4126 dolichol-phosphate
FT                   mannosyltransferase; PFAM: glycosyl transferase family 2;
FT                   GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62823"
FT                   /db_xref="GOA:D7DYK0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR039528"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK0"
FT                   /inference="protein motif:PRIAM:2.4.1.83"
FT                   /protein_id="ADI62823.1"
FT                   /translation="MNANSSNSLLVVPTGALKISEHPLTDFHRDNPILLSLVIPTYKER
FT                   NNIENIVNILSRLLDEAIPGNYELIIVDDDSPDLTWELAQSLLPDYPQLRVMRRQEEWG
FT                   LSSAVIRGWQVATGRILGVIDGDLQHPPEVLIQLLQKIEEGADLALASRHVDGGGVSSW
FT                   TIIRRFLSRGAQVLGLIILPGVLGRVTDPMSGYFMVRRSAIAGATMNPVGYKILLEVIG
FT                   RGQVREIAEAGYIFRERTEGESKVTWKQYVEYIQHLIRLRVSTGRLGKISQKVNFPVGR
FT                   FIRFGVVGFSGVFVDMAVLYLLSDPSTLALPLTRSKIISGEVAIFNNFLWNDAWTFADV
FT                   SMQQKGWNQTIKRFLKFNVICLAGLVLNVVVLNIVFNLLIPNRYIANLIAIAVATIWNF
FT                   WVNLKLSWRVTDVK"
     atgaatgcaa actcatcaaa ctccctatta gtagttccca ctggggcatt aaagatttcc        60
     gaacatccac ttactgattt ccatagagac aatcccattc tgttatctct ggtgattcct       120
     acttataaag agcgtaataa tattgagaat atcgtcaata tcctcagtag gttgctggat       180
     gaagctatcc ctggtaatta tgagctaatt atagttgatg atgatagccc ggacttaact       240
     tgggaactag cacaatctct acttccagat tatccgcagt tgcgggtgat gcgtcgtcaa       300
     gaggaatggg gactatcttc agcggtgatt cgtggttggc aagttgccac agggcgtatt       360
     ttgggtgtga ttgatggaga tttacaacat ccaccagaag tgttaataca actgttgcag       420
     aagatagaag agggggcaga tttggcttta gccagtcgtc acgtagatgg cggtggcgtg       480
     agtagttgga ctataatcag gcgctttttg tctcgtgggg cgcaggtttt aggtttgatt       540
     attttacctg gtgtattggg tagagttact gacccaatga gtggttattt tatggtgcgt       600
     cggagtgcga tcgcaggtgc aacaatgaat cctgtagggt ataaaattct cctagaagtg       660
     attggtcgcg gacaagttag agaaattgct gaagccggtt atatctttcg tgaacgtact       720
     gaaggcgaaa gcaaggtaac gtggaagcaa tatgtagagt atattcaaca cttaatccgt       780
     ttacgagtat ctactggacg gttaggcaaa attagtcaaa aagttaattt ccccgttggt       840
     cgatttatcc gctttggtgt agtgggattc agtggggtat ttgtagatat ggcagtgctt       900
     tatttactca gtgacccttc aactctggct ttacctttaa cgcggagtaa aattatttct       960
     ggtgaagttg ccattttcaa taatttttta tggaatgatg cgtggacatt tgcggatgtt      1020
     tccatgcaac aaaaaggttg gaatcaaaca atcaaacggt ttttgaagtt taatgtgatt      1080
     tgcttggcag gattggtttt aaatgtagtt gttttgaata tagtctttaa tttattgatt      1140
     cctaatcggt atattgccaa cttaattgcg atcgcagttg ctacaatttg gaatttctgg      1200
     gttaacctga aactaagttg gcgggtaact gatgtgaaat ag                         1242
//

If you have problems or comments...

PBIL Back to PBIL home page