(data stored in SCRATCH zone)

EMBL: CP002059.PE161

CP002059.PE161       Location/Qualifiers
FT   CDS_pept        192279..195065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0203"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="KEGG: npu:Npun_R1597 GAF sensor signal transduction
FT                   histidine kinase; PFAM: ATP-binding region ATPase domain
FT                   protein; GAF domain protein; SMART: GAF domain protein;
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62829"
FT                   /db_xref="GOA:D7DYK6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADI62829.1"
FT                   /translation="MFYGLKNLFVGMGLRAYPHIFILYKHNTQTNIEYLLLPYRRIILT
FT                   TLWGMIQPTSQKEYQPGMIFSLDQSEKQKALSRVIARIRESLDIETIFKITVTEVRQLL
FT                   NTDRVGVFRFYPDLEWEGEFLYEDVGTEWISILATKLHDHCFAEEFTELYQEGRIKAIS
FT                   DIYEDVVTDCHVTMLEKFQVRANIAVPLMKCKDLWGLLCIHQCNNPRQWEASEIEFVQL
FT                   IAQHLGVALQQADYIEQMKLQSAQLAQAKAREKAAEWQKTIARTIEKIRQSLDLESIFR
FT                   TTTEELRQLLNSDRVSIYRFNPDWSGDFVFESITSGWVTLMQEQLQRPELRDNISNCNL
FT                   KELVEPPTDTYLQDTGGGQFAKGEIYRICNDIYSAGFNECYIKILESYQARAYVIVAIL
FT                   YNHKIWGLLAVYQNTGTRDWQEDEIYLLTQVSSQLGVALQQAESLKQMQVQAQKLAKAA
FT                   ERERKAAEREKALAATVEKIRQSLDLNTIFATSTQEVLRLLEVDRVTIYRFRPDGSGEF
FT                   VAESLAYGWKSVQELVPVIADDYLRLIPREDSTNGKIIVVNDTSATNIPIPHIALITPT
FT                   ETRAYMIVPIFQGEKLWGLLAAYQHSQTRDWQKDEVDLLVQIGSQLGVGLQQAELLGKT
FT                   QRQKEEITQTLKELQATQSQLIQSEKMAGLGQLVAGLAHEINNPISFIYGNIPYVTNHM
FT                   EDLLNLVCLYHKNHPQSTQEIAQQTADIDLDFIADDLPKMLNSMMIGANRIRELVLSLR
FT                   TFARLDEAEKKPLDLHEGIDSTLLILQNRLQPQGDFPAIEIVKEYGNLPQVFCYGAQMN
FT                   QVFMNIINNAIWALEQSLADSRLTDKPKIWIRTQVTDRNYILIWIADNGCGIKKGMESR
FT                   IFEPFFTTKEPGQGTGLGLSISYQIIVEKHGGQINCVSEPGKGCELWIEIPMTENRA"
     atgttttatg gcttaaaaaa cctatttgtg gggatgggat tgagagcgta tccccacata        60
     ttcatattat acaaacataa tacacaaacc aatattgaat atttattgtt accttataga       120
     agaattatat tgacaaccct gtggggaatg atacaaccta cttcccaaaa agaatatcaa       180
     ccaggcatga ttttttccct ggatcagagt gagaaacaaa aagctttatc tagagtgatt       240
     gcccggattc gggaatctct agatatagaa accatcttca aaataacagt cacagaagta       300
     cgtcagttac tcaacacaga tagggttggc gtatttcgat tttatcctga tttggaatgg       360
     gaaggggaat ttctttatga agatgtaggc acagaatgga tatctatatt agctaccaaa       420
     ctccatgacc actgctttgc tgaagagttt accgaacttt atcaggaagg gagaattaaa       480
     gccatatcag atatttatga agatgttgtc acagattgtc acgtcacaat gctggaaaag       540
     tttcaagtac gtgccaacat agctgtaccc ctcatgaaat gcaaagatct atggggatta       600
     ctgtgtattc atcaatgtaa taacccacga caatgggaag catcagaaat tgaatttgtg       660
     caattaatag ctcaacattt gggagttgct ttacaacaag cagattatat agaacagatg       720
     aaattacaat ctgcccagct tgcacaagct aaagctagag aaaaagccgc agaatggcaa       780
     aaaactatag cgcgaaccat agaaaaaatt cgtcagtctc tagatttaga aagcattttt       840
     cgcaccacca ccgaagaact cagacaatta ctaaatagcg atcgggtttc tatttatcgt       900
     ttcaatcctg actggagtgg tgattttgtg tttgaatcta taacatcggg ttgggttact       960
     cttatgcaag aacagttaca gcgtcccgaa ttaagagaca acattagcaa ctgtaactta      1020
     aaggaattag ttgaaccacc cactgataca tatttgcaag atacaggagg aggtcagttt      1080
     gctaaaggag aaatataccg gatttgtaat gatatttata gtgctggttt taacgaatgc      1140
     tacatcaaaa ttttagaaag ctatcaagcc agagcttatg tcatagttgc aattctttat      1200
     aaccataaaa tttggggttt attagccgtt tatcaaaaca caggaactag agattggcaa      1260
     gaagatgaaa tttatctact cacccaagtt agttctcaat taggtgtagc attacagcaa      1320
     gctgaatcat tgaaacaaat gcaagttcaa gctcagaaac ttgctaaagc tgcggaaaga      1380
     gaacggaaag cagcagaaag agaaaaagct ttagctgcaa ctgtagaaaa aattcgccag      1440
     tctcttgatc taaatactat ctttgctacc agcactcaag aggtcttgcg gttattagaa      1500
     gttgatcgcg tcacaattta ccgatttcgt ccagatggga gtggtgaatt tgtggccgag      1560
     tcattagctt atggatggaa atcagtacag gaacttgtgc cagtaattgc agatgattat      1620
     ctacgattaa ttccaagaga ggactctacc aacggtaaaa taatcgttgt taacgacaca      1680
     tctgccacaa atattcctat tcctcatatt gccttaatta caccaacaga aaccagagca      1740
     tatatgattg tgccaatttt tcaaggagaa aaactctggg gattattggc agcttatcaa      1800
     cattctcaaa cccgtgattg gcagaaagat gaggtagatt tgttagtgca gattggttct      1860
     caattaggag taggactcca gcaagccgag ttgttaggaa aaacccaacg ccaaaaagaa      1920
     gaaattaccc aaactctcaa ggaattacaa gcgactcaaa gccagttaat tcaaagtgaa      1980
     aaaatggctg gtttaggtca attggtcgct ggtttagcac atgaaattaa caacccaatt      2040
     agtttcattt acggtaatat tccttatgtt actaatcata tggaagattt attgaattta      2100
     gtgtgtctat atcataaaaa tcatcctcaa tcaacacaag agattgcaca gcaaacagca      2160
     gatatagatt tagatttcat cgctgatgat ctgcccaaaa tgctcaattc aatgatgatt      2220
     ggtgcaaata gaattagaga attagtgctt tcattacgga ctttcgcacg ccttgacgaa      2280
     gcagaaaaaa aacctcttga cttacatgaa gggatagaca gtacactttt aattctccaa      2340
     aatcgtctcc aaccacaggg agattttcct gctattgaaa ttgtgaagga gtatggtaat      2400
     ctacctcaag tcttttgcta tggagctcag atgaatcagg tgtttatgaa tattatcaat      2460
     aatgcgattt gggcgctaga acaatcatta gcagatagca gattaactga caagcctaaa      2520
     atttggattc gtacacaagt tacagatcgg aattatattt tgatttggat tgctgacaat      2580
     ggttgtggga tcaagaaagg catggaatca cgcatttttg aacccttctt caccacgaaa      2640
     gaaccaggac aaggtactgg tttagggcta tctattagct atcaaattat tgtcgaaaaa      2700
     catggtggtc agattaactg tgtttcagaa cctggtaagg gttgtgagtt gtggattgaa      2760
     attcccatga ctgaaaatag agcgtaa                                          2787
//

If you have problems or comments...

PBIL Back to PBIL home page