(data stored in SCRATCH zone)

EMBL: CP002059.PE164

CP002059.PE164       Location/Qualifiers
FT   CDS_pept        196442..197065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0207"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /note="KEGG: ava:Ava_4633 anaerobic
FT                   ribonucleoside-triphosphate reductase activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62832"
FT                   /db_xref="GOA:D7DYK9"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012837"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYK9"
FT                   /inference="similar to AA sequence:KEGG:Ava_4633"
FT                   /protein_id="ADI62832.1"
FT                   /translation="MGTKLTEALLAQQEIPAGYLNIMGYVDKSEVNGPGCRAVVWVQGC
FT                   PRECAGCFNPDSWTFEINQLVAIDSLGADILKNPHNTGVTFSGGEPFWQASALANLARK
FT                   VKVAGLNVMAFTGFTLKQLQSESAPPGSEELLEQLDILIDGPFVESQAINSPLSPVSSR
FT                   NQQVHVFNPEFKDQITWASDQIEVHVLKDGDRIVTGYQGWLELT"
     atgggaacaa agttaacgga agcattgtta gcacagcaag aaattcctgc tggttatctc        60
     aatattatgg gttatgttga taaatcagaa gtcaacggtc ctggttgtcg tgctgtggtg       120
     tgggtgcaag gctgtcctcg tgagtgtgct ggttgcttta atcccgactc ttggacattt       180
     gagattaacc agctagttgc tatagattcc ttaggcgcag atattctcaa aaatccccat       240
     aacacaggtg taactttctc tggtggtgaa ccattttggc aagcatcggc attggctaat       300
     ttagcacgta aagtcaaagt tgctggatta aatgtcatgg cttttactgg ttttaccctg       360
     aagcaactgc aatctgaatc agcacctcca ggttctgaag aattgttaga acagttagat       420
     attttaattg acgggccttt tgttgagtct caagccatta attctccctt atctcccgtt       480
     tcttctagaa atcaacaggt tcatgtattt aacccagaat tcaaagatca aattacctgg       540
     gctagtgacc aaatagaagt tcacgtcctc aaagatggcg atcgcattgt gactggttat       600
     caaggttggt tagaactgac ttaa                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page