(data stored in SCRATCH zone)

EMBL: CP002059.PE174

CP002059.PE174       Location/Qualifiers
FT   CDS_pept        complement(220142..224398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0225"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; PAS fold-3 domain protein;
FT                   CBS domain containing protein; PAS fold domain protein;
FT                   histidine kinase A domain protein; response regulator
FT                   receiver; KEGG: npu:Npun_F4948 multi-sensor hybrid
FT                   histidine kinase; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS domain
FT                   containing protein; CBS domain containing protein; PAC
FT                   repeat-containing protein; response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62842"
FT                   /db_xref="GOA:D7DYL9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYL9"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ADI62842.1"
FT                   /translation="MQFNDHLIDLPSLHKVIDRYPLTISPDSHVIEAINLMNQEENHSC
FT                   NLYNVARSLLRSKQQKKVNSYILIVQQGQLLGIFTLADVLKLIALNMDLAKTTMVEVMT
FT                   QPVITLKLSDLDHISTVLYFLQQYSVQDLPIVDDEGNLVGIINESSLLHELDLVKVVGV
FT                   VEAVNQTLTNITNQSPENYQQREKVSGKTDNLLKTWIEEKIAKEIQINEELQQTLEELQ
FT                   IIKEELRQQNKQLATAREITESERRRYQDLFEFTPNGFLVTDKLGVIQEANHAASSLLC
FT                   VHQKYLVGKPITIFLGQSDRHNVLSHLSLSQHFQEWEIYIQPREGVPFPASIRLRAVYD
FT                   RQGQWLGWCWLICNISVQKQAEKTLRRSSDELEQRVAERRRELIVANQALEQEIKERKE
FT                   TQAALRKSEETFRQFAENLEAYIWICSQDCSTLFYINPAYEKIWGRSCQSLWENPLSWI
FT                   EAVHPEDLEPMMAEVEKQHQKGENISVQYRIIRLDGSIRWLWSRRFPIKNEQGQIQYYG
FT                   GIGEDITERKQTEAAVRESEYKFHQFADNIQAVVWIASVDCTENVYVNPAYEKFWGRSR
FT                   ASMGNNPKSWIEGVHPQDRDRVIAQIQSQKDNESGVLEYRVLRPDGSISWLWARRFTIK
FT                   NEQGQIQYFGGIAEDITEHKQTEAALKKTEEKFRYFTENSDTLIWMASKDSKETLYINP
FT                   AYEKIWGRSCQSLRENPQSWREAIHPEDRDRILAEIEEHHQKGEGANLEYRIVQPNGSI
FT                   RWIWGRCFPVKNEQGELDYYGSLTEDITDRKLAEESLRDSETRLTLALENANMGIWECN
FT                   LITDQCICSDNVGPLYGLPKGSVCPSSHEEFFNFFYPEDREFCIQAVKRAIEQEGEFAV
FT                   EYRVVWPDGSLHWLRGTGKVYHNQQGQPIRMIGTTRDISERKETEHQLYEQAALLDIAT
FT                   DAIFVRDFQTKILFWNQGAERIYGWQKHEAVGKNLKDLFCSKTTQQQESSALRTVVKLG
FT                   TWQGELRKKTKLGQEIIVESRWTLMFDADGQPKSILIVDSDITEKKQLEEQFFRTQRLE
FT                   SIGTLAGGIAHDLNNILTPILGAAQLLKGRFAKDEERHPQLLAIIENNAQRGAALVKQV
FT                   LSFARGLKGERGIVQVKHLIAEIIQIGKQTFPKSIEFTTQIPENLWTVSGDTTQLHQVL
FT                   MNLVVNARDAMPEGGTLTITTENIYIDEAYTRMLIESKIGNYIVITVTDTGVGMTKEIL
FT                   DRIFEPFFTTKEFKGGTGLGLSTALGILKSHNGFVTVSSQVGKGSTFKVFLPSVESPQV
FT                   PDIDQSKIPSGQGELILVVDDEPQIRDVATIILENHNYQTLTASNGVEAIVLYAQHKKN
FT                   ISAVLMDMMMPEMDGITAIRTLKKMNPKVQVIACSGLNTKDVFPESDEMEVQSVLFKPY
FT                   TANELLRNLNQIIRNS"
     atgcaattca acgatcatct aattgatttg ccttctttac ataaagttat tgatcgttac        60
     cctttgacga ttagccctga tagtcatgtg attgaggcta ttaacttgat gaatcaggag       120
     gaaaatcata gctgcaactt atacaatgtt gccagatcat tacttcgcag caaacagcag       180
     aaaaaagtaa atagctatat tttaatagta cagcaagggc agttactagg aatattcacg       240
     cttgcagatg tattaaaatt aatagcattg aatatggatt tagccaagac aacaatggtt       300
     gaagtgatga cccaaccagt cattacattg aaactatccg atttagatca tatttcaact       360
     gttttatact ttttgcagca atatagtgtt caggatttac cgattgttga tgatgaggga       420
     aatctagtag gcataattaa tgaatctagc ttgttacatg agttagattt agtcaaggtt       480
     gttggtgttg ttgaagctgt aaatcaaacg ttaacaaata tcacgaatca gtccccggaa       540
     aactatcagc aacgagagaa agtaagcggc aaaactgata acttgttgaa aacatggata       600
     gaggaaaaaa tagccaaaga aatacaaatt aatgaagaac ttcagcaaac cttagaagaa       660
     ttgcaaatta ttaaagaaga attacgccaa caaaataaac aactggctac tgctcgtgag       720
     ataacggaat cggagcgccg acggtaccaa gatttatttg aatttactcc taatggtttt       780
     ttagtaactg ataaattggg tgttattcaa gaggctaatc atgcagcttc atctttactc       840
     tgtgtgcatc aaaagtacct agttggcaag ccaattacaa tttttcttgg tcaatcagat       900
     cgccataatg ttctctccca tctgagtctt tctcagcact tccaagaatg ggaaatttac       960
     attcaaccga gagaaggggt gcccttcccc gccagtatta gattaagggc tgtgtatgat      1020
     cgccaaggtc agtggcttgg ttggtgttgg ttaatatgca atattagtgt acagaaacaa      1080
     gctgagaaaa cactgcgtcg aagctcagat gagttggaac aacgagtggc agaacgcagg      1140
     agagaattga tagttgctaa tcaagctttg gaacaagaaa tcaaggagcg taaagaaacg      1200
     caagctgctt tgcggaagag tgaggagaca tttcgccaat ttgctgaaaa tctcgaagca      1260
     tatatatgga tttgttccca agattgcagc accctctttt atatcaaccc ggcttatgag      1320
     aaaatttggg gtcgttcttg ccaaagtctg tgggaaaatc ctctatcttg gatagaagct      1380
     gttcatccag aagaccttga gcccatgatg gcagaggtgg agaagcagca tcaaaagggt      1440
     gaaaatatta gcgtacagta tcgtattatc cgtttggatg gttcaatacg ctggttgtgg      1500
     tctagacgtt ttcctatcaa gaatgaacaa ggacagattc aatactatgg tggcattggt      1560
     gaagatataa cagaacgcaa acaaacagaa gcagcagtca gggagagtga atataagttc      1620
     caccaatttg ccgacaacat tcaagcagta gtttggattg cttccgtgga ttgtacagag      1680
     aacgtctatg tgaaccctgc ctatgagaaa ttttggggtc gttctagagc aagtatgggt      1740
     aacaatccta aatcttggat agagggagtt cacccccaag atcgtgatcg cgtcattgca      1800
     caaatacaaa gtcaaaagga taatgaatct ggcgttctag aatatcgagt tctacgacct      1860
     gatggatcaa taagctggct atgggctaga agatttacca tcaaaaatga acaaggacag      1920
     attcaatact ttggtggcat tgccgaagat atcacagaac acaagcaaac agaagctgca      1980
     ctcaagaaga ctgaggaaaa attccgatac tttaccgaaa atagcgatac cctaatctgg      2040
     atggcctcca aggatagtaa ggaaacccta tatattaacc cggcttatga aaaaatttgg      2100
     ggacgctctt gccaaagtct gcgggaaaat cctcaatcat ggagagaagc gattcatcca      2160
     gaagaccgcg atcgcatttt ggcagaaata gaggagcatc atcaaaaagg tgaaggcgct      2220
     aatttagagt atcgcatcgt acaaccgaac ggatcaatcc gctggatttg gggtagatgc      2280
     tttcccgtta aaaatgaaca aggcgagctt gactactatg gtagtctgac cgaagacatt      2340
     accgacagga aactagctga agaatctctg cgagacagtg aaacgcgact aactctagcc      2400
     ctagaaaatg ctaacatggg tatatgggag tgcaacctga ttaccgacca atgtatttgc      2460
     tctgataatg tagggccact ttatggacta ccaaaaggta gtgtatgtcc atcatcccat      2520
     gaagaattct tcaatttctt ctatcctgaa gatcgtgaat tttgcattca ggcagtgaaa      2580
     cgcgctattg aacaagaagg cgaatttgcc gtagaatatc gcgtcgtttg gcctgacggc      2640
     agcctacact ggttaagggg tactggaaag gtctaccaca accaacaagg tcagcccatc      2700
     aggatgattg gtacaactag agatatatct gaacgcaagg aaacagagca ccaactctat      2760
     gaacaagcag cattattaga tatcgctacc gatgccattt tcgtgcgaga ttttcagaca      2820
     aaaatcttat tttggaatca aggtgcagaa agaatatatg gttggcagaa acatgaagct      2880
     gtgggtaaaa acctcaagga tcttttctgt tctaaaacta cacaacaaca agaatcaagc      2940
     gcactcagaa cagtagttaa attgggaact tggcaaggtg agctacgtaa gaaaacaaaa      3000
     ttaggccaag aaattattgt tgaaagtcgt tggacactga tgtttgatgc cgacggtcaa      3060
     ccaaaatcta tcttgattgt agatagtgac attacagaga aaaaacaact ggaagaacag      3120
     tttttccgca cccagcgatt agaaagcatt ggtactttag ctggtggtat tgcccacgac      3180
     ttaaataata tattaactcc cattttagga gcagcacaat tactaaaagg tagatttgcc      3240
     aaagatgaag aacgtcatcc ccaactattg gcaatcatag aaaataatgc tcaacgtgga      3300
     gctgctttag tcaaacaagt cttatctttt gccaggggat taaaaggaga aagaggtatt      3360
     gtccaagtga aacatctgat tgcagaaatt attcaaattg gtaaacaaac atttcccaaa      3420
     tctatcgaat ttaccaccca aattccagaa aacctgtgga ctgtttctgg agacaccaca      3480
     caactacatc aggtattaat gaatctggta gttaatgccc gtgatgctat gccagaaggt      3540
     ggcactctca caattactac agaaaatatt tatattgatg aagcttacac ccggatgctg      3600
     attgaatcca aaattggcaa ttacattgtt attactgtca ccgatacagg tgtaggaatg      3660
     actaaagaaa tattagatag aatttttgag ccatttttca ccacgaaaga atttaaaggt      3720
     ggaacaggat tgggtttgtc aactgcttta ggaattctta aaagccataa tggttttgta      3780
     acagtatcca gtcaagtggg taaaggcagt acatttaagg tattcttacc atctgtagaa      3840
     tctcctcaag ttcctgatat agatcaatcg aaaataccat caggacaagg agagttaatt      3900
     ttggtagtag atgatgaacc tcaaattcgt gatgtagcca caattattct agaaaaccac      3960
     aattatcaaa ccctaactgc tagtaatgga gtggaagcga tcgtactgta tgcccaacac      4020
     aaaaaaaata tcagcgcagt attgatggat atgatgatgc cagaaatgga tgggataacc      4080
     gctattcgca ccttgaaaaa aatgaaccca aaagttcaag tgattgcttg tagtggacta      4140
     aatacaaaag atgtattccc agaatcagac gaaatggaag tgcaatccgt tttattcaaa      4200
     ccctacactg ccaatgagtt attaagaaac ttaaatcaaa taattcgtaa ttcataa         4257
//

If you have problems or comments...

PBIL Back to PBIL home page