(data stored in SCRATCH zone)

EMBL: CP002059.PE183

CP002059.PE183       Location/Qualifiers
FT   CDS_pept        238564..238719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62851"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADI62851.1"
FT                   /translation="MVINETLTTHSGVRFKILIMSGSSQYIAKNIFFYFISMKCYLALA
FT                   KNIDIY"
     atggttatta atgaaacact aactactcac tcaggagtaa ggttcaaaat cttaattatg        60
     tcaggttcat cacaatatat tgctaaaaac atattttttt atttcatttc tatgaaatgt       120
     tatttagcat tagcgaaaaa tattgacatt tattaa                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page