(data stored in SCRATCH zone)

EMBL: CP002059.PE199

CP002059.PE199       Location/Qualifiers
FT   CDS_pept        complement(275062..275259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0274"
FT                   /product="lrrA; putative protein"
FT                   /note="KEGG: lrrA; hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DYP4"
FT                   /inference="similar to AA sequence:KEGG:DDB_0215361"
FT                   /protein_id="ADI62867.1"
FT                   /translation="MAVPEPIFELTNLKKLKFSVKSGIHCVFSPKNGHLHQLQELEIVG
FT                   TFDHYQPDEIGEISGLEKVN"
     atggcagtgc cagagcctat ttttgaactg acaaatctga aaaagctgaa gttcagtgtg        60
     aaatctggca tacactgtgt tttttccccg aaaaatggtc acctgcacca attgcaagag       120
     ttagagattg tggggacttt tgatcattat caaccagatg aaattgggga aatatcaggt       180
     ttagagaagg taaattaa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page