(data stored in SCRATCH zone)

EMBL: CP002059.PE234

CP002059.PE234       Location/Qualifiers
FT   CDS_pept        complement(320147..322603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0319"
FT                   /product="type II and III secretion system protein"
FT                   /note="PFAM: type II and III secretion system protein; NolW
FT                   domain protein; Secretin/TonB short domain; KEGG:
FT                   ava:Ava_3689 type II and III secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62902"
FT                   /db_xref="GOA:D7DZF0"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF0"
FT                   /inference="protein motif:PFAM:PF00263"
FT                   /protein_id="ADI62902.1"
FT                   /translation="MKQVHSNVLISSATACVLLAAQPASAQTTQITQVQLSPAEGGISV
FT                   ILKTSAGEKPQVFTTQRGNALVADIINTKLLLLQGNNFRQENPAPGIASVEVNQLNANS
FT                   VRVTVTGNDTAPNSKPVMRQDNSLTLSFTSSRDATTSITPNTDTTAAVPITPAATPVEP
FT                   GKKIEVLVPNPEVTIDGKPAQPAGPNQPYNQAPPFLPRAVAPPVGDITVSNIDTSPTSI
FT                   DLGTQERVPRLVLRDAPVREVLSLLARAAGMNVAYIGSEGAAATPPAGGQLAATTSQTI
FT                   SLDIENEAVQDVFNYVLRLSALEANRSGRTIFVGAKLPNSTRDNVMRSLRLNQVTVGVA
FT                   LNFLVALGAESAVSRERLVTSVNAVPVGSAANAAITQTQTTTETKIETQRIDYKDSVPL
FT                   LRGLQASGDERTNSVTLVGNPKIVEMAISQLTQLDVRRRQVVVNVKIIDVNLLGIQDYT
FT                   SSFSFGIGDNYFSNDGGAATFNFGGSRPATSSEVANSITDTPVITNPITGEPFLSTTES
FT                   TTLTGAGPGTTIINQSASVVPLGDGTTLAPGGIKVIPNTDATTFTPISSASSNPLQPGF
FT                   TSITQSTNNIITINADGTTSVTQGTAGTATASLPSLYKFPKRFLASLQAQVQTGNAKIL
FT                   TDPTLIVQEGQDAVVKLTSEVYGGIRITDTLREPIIKEAGLTLAVKVERIDDNGFVSLS
FT                   VAPTVSAFANSASTPDGNIALLAARSLQSGILRLRDGQTLILSGIIQDQDRTTISKLPI
FT                   LGDIPLLGSLFRKTNRQNERREVIVLLTPQVMDDSERSAYGYNYNPSSQVRQILERRGL
FT                   KVPNNR"
     gtgaaacaag ttcatagtaa tgttttaatc tcaagtgcaa ctgcttgtgt actcttagca        60
     gcccagccag cttcggcaca gaccactcaa attactcaag tacaactaag tcctgctgag       120
     ggaggaatta gtgtcatttt aaagacctct gctggtgaga agccccaagt atttaccaca       180
     cagcgtggta acgccctagt cgcagatatt attaatacca aattgctttt actgcaaggt       240
     aataatttcc gccaagaaaa ccccgccccc ggaatagcat cggtagaagt aaatcaatta       300
     aatgctaata gtgtgcgtgt gacggtcact ggtaatgata ccgctcctaa tagtaaaccc       360
     gtcatgcgtc aagataacag tctgaccctg agctttactt ctagcagaga cgcgacaaca       420
     tctataacac caaatacaga tactaccgca gcagtaccta taacccctgc tgctactcca       480
     gtcgaaccag gcaaaaagat agaagtgcta gttcctaacc cagaagtaac aattgatgga       540
     aaacctgcac aaccagcagg acctaatcaa ccttacaacc aagcacctcc cttcttgccc       600
     agagctgttg ctcccccagt aggagatatt acagtatcta acattgatac ttctcctacc       660
     agtattgatt taggaactca ggaacgagtg ccgcgtttag tattgcgaga tgcgccagtt       720
     agagaagttt tatcactgct ggctcgtgct gctggtatga acgtagctta tataggcagc       780
     gaaggagcag cagcaacacc acctgcggga ggccaactgg ctgctaccac cagtcaaacg       840
     atttctctgg atattgaaaa tgaagcagtg caagatgtat ttaattacgt tttgcgtttg       900
     agtgctttag aagctaaccg cagtgggaga acgatttttg tcggggctaa attgcctaat       960
     tccacccgtg ataatgtcat gcggagtttg cggctgaatc aggtaacggt tggtgttgct      1020
     ttaaattttt tagttgcctt gggtgcagaa agcgctgtta gccgtgaaag actggttact      1080
     agcgtgaatg ctgtgcctgt aggtagtgct gctaatgccg caattaccca aactcagacc      1140
     actacagaaa caaaaattga gacgcaacga attgactaca aagattcagt acccttactc      1200
     agagggttac aagcatcagg agacgaacgg acaaattctg tcaccttagt tggaaatcca      1260
     aaaatagttg agatggcaat atctcaactc actcaacttg atgtccgtcg tcgtcaagtt      1320
     gtggtcaacg tcaaaattat tgatgtcaac cttttaggta ttcaagacta tacctctagc      1380
     ttttcctttg ggattggtga taattacttc tctaatgacg ggggtgcagc aacttttaat      1440
     tttggtggtt ctagaccagc taccagtagt gaagtggcaa atagtatcac tgacacacct      1500
     gtgatcacaa atccaattac aggagagcct ttcttaagta ccactgaatc tacaacgctt      1560
     acaggtgcag gtcccggtac aacaattatt aaccaatctg caagtgtagt gcctctaggg      1620
     gatggcacta cacttgcacc cggaggtatt aaagtaatcc ctaacacaga tgctactaca      1680
     tttacaccca tttcatcggc atcgagtaat cccctacaac caggttttac atcaattact      1740
     caatcaacaa ataatatcat cactatcaat gcagatggaa ctacaagcgt aacacaaggt      1800
     actgctggca cagcaacagc atctttacct tctctgtaca aattccccaa acgtttcctt      1860
     gcaagtttac aggctcaggt acaaactggg aatgcgaaga ttttgactga tccaacctta      1920
     attgtgcagg aaggacagga tgctgtagtt aagttaacct cagaagtata cggaggtatt      1980
     agaatcaccg acacactgag agaaccaatc atcaaggaag cgggtttaac tctagcagtt      2040
     aaagtagaga ggattgatga caatggtttc gtgtccttgt ctgttgcacc aactgtatct      2100
     gcatttgcta atagtgcatc aactcctgat ggcaatattg ccttattagc agccagaagt      2160
     cttcaatctg gtatacttcg cttacgagat ggtcaaaccc tgattttatc cggcattatt      2220
     caagaccaag accgaactac tatttccaag ctgcctatct tgggtgatat tcctctgctt      2280
     gggtcgctgt ttagaaaaac aaacagacag aatgaacgta gggaggtaat tgtgttactc      2340
     acaccgcagg taatggatga ctcggagcgt tctgcttatg gttataacta caatcctagt      2400
     tcacaggtgc gacaaatcct ggagcgtcgt gggttgaagg ttcctaataa tcgttaa         2457
//

If you have problems or comments...

PBIL Back to PBIL home page