(data stored in SCRATCH zone)

EMBL: CP002059.PE235

CP002059.PE235       Location/Qualifiers
FT   CDS_pept        complement(322743..323522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0320"
FT                   /product="type IV pilus assembly protein PilO"
FT                   /note="KEGG: npu:Npun_F5007 type IV pilus assembly protein
FT                   PilO"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62903"
FT                   /db_xref="GOA:D7DZF1"
FT                   /db_xref="InterPro:IPR034756"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF1"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5007"
FT                   /protein_id="ADI62903.1"
FT                   /translation="MTLSDDLSFSQQNTNFDDAASSYRSVFGITLTPQIIGGSVGGIGF
FT                   LAAVYMILNMVMPAWDNFQQLQTKSTELQGQVDQKRLQAKQADKVKTELADVKKQQIQV
FT                   LGLFANERSLDTLLMDTSRLVDSSNAQITANDAIRAKLKRFVPAADKAEIIADNSLGEK
FT                   VNNKLKRRVVKVEIEGNFEQTQSIMRNIERLQPLLLVQNYDSKLVPPEVDKANDEKKKA
FT                   VRTGIGKLSTSFDLVALMPLTAEEAAELAAKAAPPAK"
     atgacactga gtgatgattt aagtttttct caacagaata ccaactttga tgatgcggca        60
     tcatcctatc gatctgtatt tggtatcact ttaacaccac agattattgg tggatcggtg       120
     ggcggtatag gatttcttgc cgccgtttat atgatactga atatggtcat gcccgcttgg       180
     gataactttc agcagttaca aaccaaaagc accgaactgc aagggcaagt tgaccaaaaa       240
     agactccaag ccaaacaagc tgacaaagta aagacagaat tagctgatgt caagaagcag       300
     caaatccaag ttttaggctt gtttgccaat gaaagaagtt tggatacttt attgatggat       360
     accagtcgct tagtagattc tagcaatgct caaatcactg ctaatgatgc cataagagcc       420
     aaactcaaac ggtttgtacc agcagcagat aaagcagaaa taattgctga taacagtctg       480
     ggagaaaaag ttaacaataa gcttaaacgc agagttgtta aggtggaaat tgaaggtaat       540
     tttgaacaaa cccagtcaat aatgcgtaat attgagcgtt tacagccttt attacttgtt       600
     caaaactatg attcaaaatt ggtaccacca gaggtagaca aagcaaatga tgaaaaaaag       660
     aaagcagtgc ggactggaat aggcaaactg tcaacgtctt ttgacctagt cgcattaatg       720
     ccattgacag cagaagaagc cgcagaatta gcagcaaaag ctgctccccc agccaagtag       780
//

If you have problems or comments...

PBIL Back to PBIL home page