(data stored in SCRATCH zone)

EMBL: CP002059.PE243

CP002059.PE243       Location/Qualifiers
FT   CDS_pept        complement(329124..329645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0328"
FT                   /product="hexapaptide repeat-containing transferase"
FT                   /note="KEGG: npu:Npun_F5001 hexapaptide repeat-containing
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62911"
FT                   /db_xref="GOA:D7DZF9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZF9"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5001"
FT                   /protein_id="ADI62911.1"
FT                   /translation="MSTVSYWTSPDFSQAAFVAPNAVVVGSINIAAGASIWYGAVLRGD
FT                   VVRIDIGECTNIQDGAILHGDPGLPTILEDHVTIGHRAVVHSAHIERGSLIGIGAIILN
FT                   GVRVGHSSIIGAGAVVTKDIPPCSVVVGIPAKIVRQLTDTETAELIEHAEKYQELALVH
FT                   ASKGTDIGFR"
     gtgtctactg tttcctactg gacatctcct gatttttctc aagccgcctt tgtcgcaccc        60
     aacgccgttg ttgttggttc aatcaacata gcagcaggcg caagcatatg gtatggcgca       120
     gtactgagag gagatgtagt acgcattgat attggcgaat gcacaaacat tcaggatggg       180
     gccattttgc atggtgatcc tggtctgcca acaatattag aagatcatgt aactataggg       240
     catcgtgctg tggtacattc tgcccatatt gaacgtggaa gtttaatagg cattggcgca       300
     ataattttaa atggagtcag agttggtcat agtagcatca ttggcgcagg tgcagtagta       360
     accaaagaca tacccccatg ttccgtagta gtcggcatcc ccgctaaaat tgtccgtcaa       420
     ctcacagaca ccgaaaccgc agaactcata gaacacgccg aaaaatacca agaattagcc       480
     ctagttcacg ccagcaaagg gacagatatt ggttttaggt ag                          522
//

If you have problems or comments...

PBIL Back to PBIL home page