(data stored in SCRATCH zone)

EMBL: CP002059.PE251

CP002059.PE251       Location/Qualifiers
FT   CDS_pept        complement(338292..338585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0337"
FT                   /product="nitrogen regulatory protein P-II (GlnB, GlnK)"
FT                   /note="KEGG: ava:Ava_2164 nitrogen regulatory protein P-II
FT                   (GlnB, GlnK)"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62919"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZG7"
FT                   /inference="similar to AA sequence:KEGG:Ava_2164"
FT                   /protein_id="ADI62919.1"
FT                   /translation="MKIVKRIEILSNSLELQNILKKLDNAGVSGYKIIQHVIGKGNRGR
FT                   VIDDLEGHGLTNGSIMNTCSEEREYQVVEAIRPVLKKFGGVCVVSDPKSIIH"
     gtgaaaattg tcaagagaat tgaaatactt agtaattctt tagaactaca aaatatttta        60
     aaaaaattag ataatgcagg cgtttctgga tataaaatta ttcagcatgt tataggcaaa       120
     ggaaacagag gtagagttat tgatgattta gaaggccatg gactcactaa tggttctatt       180
     atgaatactt gtagtgaaga acgagaatat caagtagttg aagcgattag acctgttctc       240
     aaaaaattcg ggggtgtatg tgttgtttct gatcctaaat caattataca ttag             294
//

If you have problems or comments...

PBIL Back to PBIL home page