(data stored in SCRATCH zone)

EMBL: CP002059.PE254

CP002059.PE254       Location/Qualifiers
FT   CDS_pept        348478..348699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyh:Cyan8802_3436 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62922"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH0"
FT                   /inference="similar to AA sequence:KEGG:Cyan8802_3436"
FT                   /protein_id="ADI62922.1"
FT                   /translation="MNETTVGEQNSSESDDLLPEYNFDYSKACPNRFASTSEKRITVIL
FT                   DPDVAKIFQISEGLNRALGCLLSAIPEK"
     atcaacgaaa caaccgtcgg tgagcaaaac tcgtctgaat cagatgattt attacctgaa        60
     tataatttcg attatagcaa agcatgtcct aatcgttttg cgtcaacttc agagaagaga       120
     attactgtga tccttgatcc tgatgtcgct aaaattttcc aaatatcaga aggactaaat       180
     cgggctttag gttgcttatt atcagcaatt cctgaaaaat aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page