(data stored in SCRATCH zone)

EMBL: CP002059.PE262

CP002059.PE262       Location/Qualifiers
FT   CDS_pept        356612..358453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0357"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="SMART: AAA ATPase; TIGRFAM: ATP-dependent
FT                   metalloprotease FtsH; KEGG: npu:Npun_F4881 ATP-dependent
FT                   metalloprotease FtsH; PFAM: peptidase M41; AAA ATPase
FT                   central domain protein; peptidase M41 FtsH extracellular"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62930"
FT                   /db_xref="GOA:D7DZH8"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZH8"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ADI62930.1"
FT                   /translation="MNKRWRNTGLYALLFIVVIALGTAFFDNQPPQVETWRYSQFIQEV
FT                   ESGRVEKVSLSSDRSTAMVTPKYDPNKKRVTLVNDPDLINTLTTKGVDIAVLPQTDEGF
FT                   WFKALSSLFFPVLLLVGLFFLLRRAQSGPGSQAMNFGKSKARVQMEPQTQVTFGDVAGI
FT                   DQAKLELNEVVDFLKNADRFTAVGAKIPKGVLLVGPPGTGKTLLARAVAGEAGVPFFSI
FT                   SGSEFVEMFVGVGASRVRDLFEQAKTNAPCIVFIDEIDAVGRQRGAGLGGGNDEREQTL
FT                   NQLLTEMDGFEGNTGIIIIAATNRPDVLDAALLRPGRFDRQVVVDRPDYGGRSEILKVH
FT                   ARGKTLSKDVDLDKIARRTPGFTGADLSNLLNEAAILAARRNLTEISMDEINDAIDRVL
FT                   AGPEKKDRVMSEKRKTLVAYHEAGHALVGALMPDYDPVQKISIIPRGRAGGLTWFTPSE
FT                   DRMDTGLYSRAYLENQMAVALGGRLAEEIIFGEEEVTTGASNDLQQVARVARQMITRFG
FT                   MSDRLGPVALGRQQGNMFLGRDIMSERDFSEETAAAIDEEVRKLVDVAYARAKEVLVNN
FT                   RHILDEIAQMLIDKETVDADELQEVLANNDVKTAAFA"
     gtgaataaaa gatggagaaa tacagggcta tatgcgctgt tatttatagt tgtaattgct        60
     ttagggactg cgttttttga caaccaaccc ccacaagtag aaacatggcg ttacagtcaa       120
     tttattcaag aagttgaaag cggtagagta gaaaaggtca gtctcagttc agaccgttct       180
     acagcaatgg ttacgcctaa atatgacccc aataaaaagc gcgtcacctt agttaacgat       240
     ccagacttaa tcaatacact gactactaaa ggtgttgata ttgcggtatt accccaaacc       300
     gatgaaggat tttggtttaa agcactcagc agtttatttt tccctgtatt acttctagtt       360
     ggtttatttt ttttattgcg tcgcgctcaa agtggacccg gtagccaagc aatgaacttt       420
     ggtaaatcta aagccagagt ccaaatggaa ccccaaaccc aagtaacatt tggtgatgtt       480
     gctggtattg accaagccaa actggaatta aacgaagtag tagacttttt gaaaaacgcc       540
     gatcgcttta ccgccgttgg tgcaaaaatt cctaaaggtg tattattagt tggacctcct       600
     ggtactggta aaaccctcct cgcacgtgcg gtagcaggag aagctggtgt acccttcttc       660
     tcaatctccg gttctgagtt tgtagaaatg ttcgttggtg tgggtgcttc ccgggtccgg       720
     gacttatttg aacaagctaa aaccaacgct ccctgtatcg tcttcattga tgaaattgat       780
     gcagtaggtc gtcaacgggg tgctggttta ggtggtggta acgacgaacg ggaacaaacc       840
     ctcaaccagt tactcaccga aatggatggt tttgaaggta acaccggcat catcatcatt       900
     gctgctacca atcgtcctga cgtactagac gcagctttat tgcgtcccgg tcgttttgac       960
     cgtcaagtgg tggtagaccg tcctgactac ggtggacgca gcgaaattct taaagttcac      1020
     gcacggggta aaaccttatc caaagatgtg gacttggata aaatcgctcg tcgtacccct      1080
     ggtttcaccg gtgcagattt atccaacctg ttgaacgaag ccgcaatttt agcagcacgt      1140
     cgcaacttaa ccgaaatttc gatggatgaa atcaatgatg ccatcgaccg tgtattagct      1200
     ggaccagaga agaaagaccg agtaatgagc gaaaaacgca aaaccttggt tgcatatcac      1260
     gaagctggtc acgctttagt tggtgcattg atgcctgact atgaccccgt acaaaagatt      1320
     agcattattc cccgtggtcg tgctggtggt ttaacttggt ttacccctag cgaagaccgc      1380
     atggatacag gtttatatag ccgtgcttat ctagaaaatc agatggctgt agctttgggt      1440
     ggacgtttag ctgaagaaat aatctttggt gaagaagaag ttaccaccgg tgcttccaac      1500
     gacttgcaac aagtagcgag agttgctaga caaatgataa ctcgctttgg gatgagtgat      1560
     cgcttgggtc cagttgcttt gggtcgtcaa caaggtaata tgttcctcgg tcgagatatc      1620
     atgtctgagc gtgacttctc cgaagaaacc gcagctgcaa ttgatgaaga agttcgtaaa      1680
     ttagtagatg tagcttacgc acgcgctaag gaagtattag tgaacaaccg ccacattttg      1740
     gatgaaatcg cgcaaatgct gattgataaa gaaacagttg acgctgatga attgcaagag      1800
     gttctagcga ataacgatgt gaaaactgct gcttttgcat ag                         1842
//

If you have problems or comments...

PBIL Back to PBIL home page