(data stored in SCRATCH zone)

EMBL: CP002059.PE268

CP002059.PE268       Location/Qualifiers
FT   CDS_pept        366305..367579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0365"
FT                   /product="processing peptidase"
FT                   /EC_number="3.4.24.64"
FT                   /note="KEGG: ava:Ava_4310 peptidase M16-like; PFAM:
FT                   peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62936"
FT                   /db_xref="GOA:D7DZI4"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZI4"
FT                   /inference="protein motif:PRIAM:3.4.24.64"
FT                   /protein_id="ADI62936.1"
FT                   /translation="MQNIDNSNSSIYRTVLPNAIVVLVVENQAADIIAGRIFVRAGSCY
FT                   EHREKAGLAHLLSSVMTKGCDGLSSLEIAEKVESVGASLSTHAGTDYFLLSLKTVSADF
FT                   ADILTLSGLLLRSPTFPETQVELEKRLALQDIRSQKEQPFNLAFEQMRQAMYQKHPYSM
FT                   SVLGTETTINSITRADLVEFHQTHFRPDNIVISIVGRITPQAALDLVGEVFGDWPQPPQ
FT                   LRPILDLPAISVKPKSCLKPLNTQQSVVMLGYMGPSVSAPGYAALKLLSTYLGNGLSSR
FT                   LFVELREKRGLAYEVSAMFSTRLFPASFIVYMCTAPENTSIALQRLRQEVELLCTTELS
FT                   TDELQTAKNKILGQYALGKQTNGQIAQIYGWYEILGLGIEFDQEFSELIKKVSSKLAMT
FT                   AANRYLQEPYLSLVGQEEAITTAVS"
     atgcaaaata tagataattc taactcctct atttatcgca ctgtattacc taatgccatt        60
     gttgttttgg tggtagaaaa ccaagctgcg gatattattg cagggcggat ttttgtgcgt       120
     gctggtagtt gttatgaaca ccgggaaaaa gctggtttag cacatttgtt atcatcagta       180
     atgacaaagg gttgcgatgg tttatcgagt ttagaaattg cagaaaaagt ggaatcagta       240
     ggagcaagtt taagcacaca tgctggtaca gattacttct tactgtcctt gaaaacagtg       300
     agtgccgatt ttgcagatat tttaacattg tcaggcttgt tgttgcgatc gcccacattt       360
     cccgaaaccc aagtagaact agaaaaacgg ttagcactac aagatattcg ctcccaaaaa       420
     gagcaaccct ttaacttggc ttttgaacaa atgcgacagg ccatgtacca aaaacaccca       480
     tactcaatgt cggtcttagg tacagaaaca accattaaca gcatcactcg tgcagactta       540
     gtagaatttc accaaaccca ttttcgtcca gataacatcg ttattagtat tgtaggacgc       600
     attacaccac aagcagcctt agacttagta ggagaagttt ttggtgattg gccacaacca       660
     ccccaactac gtcccatact agatttacca gcaatttctg tcaaacccaa atcctgcctc       720
     aaacccttaa atacacagca atcagttgtc atgttgggct acatgggtcc ctcagtcagc       780
     gcccctggat acgcagccct gaaattatta tctacctact taggaaatgg gctttctagc       840
     cgcttatttg tagaattacg agaaaaaaga ggtttagcct atgaagtctc tgctatgttc       900
     tccacacgcc tctttcccgc ctcatttata gtttatatgt gtactgcacc ggaaaatacc       960
     agtatagccc tacaacgact acgccaagaa gtagaactat tatgtactac tgaactatca      1020
     accgacgaac tgcaaacagc caagaataaa attttgggac agtatgcatt gggtaaacaa      1080
     actaacggac aaatagctca aatatacggt tggtatgaga ttttaggttt aggaattgaa      1140
     tttgaccagg aattttccga actcattaag aaagtcagtt ccaagttagc aatgacagca      1200
     gctaatcggt atttacaaga accgtattta tctttagttg gacaagagga agcgattaca      1260
     acagcggtaa gttag                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page