(data stored in SCRATCH zone)

EMBL: CP002059.PE288

CP002059.PE288       Location/Qualifiers
FT   CDS_pept        complement(402083..402388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0399"
FT                   /product="NADH-ubiquinone oxidoreductase chain 4L"
FT                   /note="PFAM: NADH-ubiquinone oxidoreductase chain 4L; KEGG:
FT                   npu:Npun_R5622 NADH-ubiquinone oxidoreductase, chain 4L"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62956"
FT                   /db_xref="GOA:D7DZK4"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK4"
FT                   /inference="protein motif:PFAM:PF00420"
FT                   /protein_id="ADI62956.1"
FT                   /translation="MQLQYFLLLAAALFCIGIYGLITSRNAVRVLMSIELLLNAVNLNL
FT                   MAFSNFLDSTLIKGQVFTVFVITVAAAEAAVGLAIVLAIYRNRDTVDMEQFNLLKW"
     atgcaacttc aatacttttt attactagca gcagctttgt tttgcattgg catctatggc        60
     ttaattacta gccgtaacgc tgtgcgggta ctgatgtcaa ttgagttgtt gctgaatgct       120
     gttaatctga atttaatggc attttccaac tttctcgatt caaccttaat taagggtcaa       180
     gttttcacag tttttgtgat tactgtggca gctgctgaag cggcggttgg gttagcgata       240
     gtgctggcca tttatcgcaa ccgtgatacc gtcgatatgg agcagtttaa tctcctgaaa       300
     tggtaa                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page