(data stored in SCRATCH zone)

EMBL: CP002059.PE292

CP002059.PE292       Location/Qualifiers
FT   CDS_pept        405360..405479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0403"
FT                   /product="cytidylate kinase"
FT                   /note="KEGG: aap:NT05HA_0349 cytidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62960"
FT                   /db_xref="GOA:D7DZK8"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZK8"
FT                   /inference="similar to AA sequence:KEGG:NT05HA_0349"
FT                   /protein_id="ADI62960.1"
FT                   /translation="MGGADVKFLLLTPELLILPTKLSYFPALMAVIIEVQQQF"
     atggggggag cagatgtgaa atttctgctt ttaactcctg aactcctaat acttccgact        60
     aaattgtctt attttccggc actgatggct gtgataattg aagtacagca acaattttaa       120
//

If you have problems or comments...

PBIL Back to PBIL home page