(data stored in SCRATCH zone)

EMBL: CP002059.PE294

CP002059.PE294       Location/Qualifiers
FT   CDS_pept        complement(407559..407729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cyp:PCC8801_4040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62962"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL0"
FT                   /inference="similar to AA sequence:KEGG:PCC8801_4040"
FT                   /protein_id="ADI62962.1"
FT                   /translation="MFEFIAFLLQRYHLVEPATQSLDIDLINDGFIGMWSERQDLTESN
FT                   AWVRSVIKNEW"
     gtgttcgaat ttattgcttt tttactacaa agatatcatc tagttgaacc tgctactcag        60
     tcactagata ttgacttaat aaatgatgga tttattggga tgtggagcga acgtcaagat       120
     ttaacagaga gcaacgcttg ggtgcgtagt gttataaaaa acgagtggta a                171
//

If you have problems or comments...

PBIL Back to PBIL home page