(data stored in SCRATCH zone)

EMBL: CP002059.PE299

CP002059.PE299       Location/Qualifiers
FT   CDS_pept        417886..418929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0413"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: npu:Npun_F5636 response regulator receiver
FT                   protein; PFAM: response regulator receiver; SMART: response
FT                   regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62967"
FT                   /db_xref="GOA:D7DZL5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR024186"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADI62967.1"
FT                   /translation="MTIPLSSYKLFHKLHPLSLLAQLSTRKVTGDLSVFTNLVSWSIYL
FT                   EEGKLTYATYSDKVFERLESHFQRLNQQIPAFNHAAYAEMGLMSEANNNNQLIANADYY
FT                   AICWLVKQEYITRAQAGMLIEELAKEVLESFICLKEGNYQLNAAHDLHELPKFCHLDLQ
FT                   SIVEHCQKQLNYRENSKPGIASNNNSQPQTQTENQLGEQYSKSRTISPAKQINHKNNQY
FT                   SLSKEFYTIACIDDSQAVLNSIQHFLDEETFSVVMINEPVKALMQIIRSKPDLILLDVE
FT                   MPNLDGYELCSLLRRHSLFKNTPIIMVTGRTGFIDKAKAKIVRSSGYLTKPFTRADLLK
FT                   VVAKHIG"
     atgacaattc ctctaagtag ctacaagttg tttcacaaac tacatcccct ctctcttcta        60
     gcacaattaa gcactaggaa agttacagga gacttaagtg tattcactaa tcttgtttct       120
     tggtcaatct atttagaaga aggtaaacta acttacgcta cttattcaga taaggttttt       180
     gaacgtcttg aaagtcactt ccaacggtta aaccagcaaa tacccgcttt taatcatgcg       240
     gcttatgcag agatgggatt gatgtcagaa gcaaacaata ataatcagtt gatagcaaat       300
     gctgattatt atgctatctg ctggctagta aagcaagagt acattactcg tgcacaagcg       360
     ggaatgctga tagaagaatt agcaaaagaa gtgctagagt catttatttg tttaaaagaa       420
     ggtaattatc aacttaatgc tgctcatgat ttacatgaac taccaaagtt ctgtcattta       480
     gatttgcaat caattgttga acattgtcaa aaacaattaa actatcggga aaatagtaag       540
     ccgggaattg catctaataa taattctcaa cctcaaacac aaactgaaaa ccaactggga       600
     gaacaatatt cgaaatcaag aacaatctca cctgccaaac agataaatca taaaaataac       660
     cagtattctc tgagtaagga gttttataca attgcctgta ttgatgatag tcaagcagtg       720
     ttgaattcta tccaacattt tttagatgag gaaacatttt cagtggtgat gattaatgag       780
     ccagtgaaag ctttaatgca aattatcaga agcaaaccag atttgatttt gctggatgtg       840
     gaaatgccta atttagatgg ttatgaacta tgttcattat taaggagaca ttcgttattt       900
     aaaaatacac cgattattat ggtgactggt agaacggggt ttattgataa agccaaagct       960
     aaaattgtta ggtcatcagg atatttgact aagcctttca caagagcaga tttgctaaaa      1020
     gtggtggcta agcacattgg ttaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page