(data stored in SCRATCH zone)

EMBL: CP002059.PE300

CP002059.PE300       Location/Qualifiers
FT   CDS_pept        418993..419508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0414"
FT                   /product="CheW protein"
FT                   /note="KEGG: npu:Npun_F5638 putative CheW protein; PFAM:
FT                   CheW domain protein; SMART: CheW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62968"
FT                   /db_xref="GOA:D7DZL6"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL6"
FT                   /inference="protein motif:PFAM:PF01584"
FT                   /protein_id="ADI62968.1"
FT                   /translation="MTNPKVTLYYQPSQKSLPDSYLKFQLNQQTTAVLSIHHTQEAIIV
FT                   PVTSVTAIPNMPAFILGLMNWRSRIIWVIDLPKMFNLEGVDYPLQQYNIIVVNVESMVL
FT                   GLVVQEIKGTIKLIADDIHSPIGQVAASLVPYLCGCVEQKEETLLVLDAQNIVNYANSC
FT                   TDYSSSKV"
     atgacaaatc caaaagtaac cctttattat caacccagcc aaaagtcttt accagatagc        60
     tatctgaagt ttcaactcaa tcaacaaact acagctgttt tatcaattca tcacactcaa       120
     gaagcgatta ttgtacctgt tacatcagta acagctatac ctaatatgcc cgcttttata       180
     ttaggattaa tgaattggcg tagtcgaatt atttgggtaa ttgatctgcc aaagatgttc       240
     aatttagaag gagtagatta tcctcttcag cagtacaata ttattgtcgt caacgtggaa       300
     tcaatggttt taggtttagt tgtgcaggag attaaaggta cgattaaatt gatagcagat       360
     gatattcatt ctcctatcgg acaagtcgca gctagtttag taccttattt atgtggttgt       420
     gtcgaacaaa aggaagaaac attgctagtt ttagatgcac agaatattgt aaattatgct       480
     aattcttgca ctgattacag tagcagtaag gtttag                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page