(data stored in SCRATCH zone)

EMBL: CP002059.PE303

CP002059.PE303       Location/Qualifiers
FT   CDS_pept        428252..430144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Aazo_0419"
FT                   /product="Transketolase central region"
FT                   /note="KEGG: ava:Ava_1655 transketolase; PFAM:
FT                   Transketolase central region; Transketolase domain protein;
FT                   SMART: Transketolase central region"
FT                   /db_xref="EnsemblGenomes-Gn:Aazo_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ADI62971"
FT                   /db_xref="GOA:D7DZL9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7DZL9"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ADI62971.1"
FT                   /translation="MTTQEQLYQWQELAQQLRVDSIRATTIAGSGHPTSSMSSADLMAV
FT                   FLSKYLRYDFDHPENPNSDRFILSKGHAAPLLYSMYKAAGVISDQELLSLRQSGSRLEG
FT                   HPTPILPWVDVATGSLGQGLPIGVGVALAGKYLDQLPYNVWVLLGDGETAEGSIWEAFD
FT                   HASHYTLDNLLAIIDVNRLGQRGQTELGWNTQAYGNRAKAFGWQAIEIDGHNLTEIDQA
FT                   FSAAVAINDRPTVIIARTKKGKGVKALEDLGGWHGKALKQDQEQQAITELGGERHITIT
FT                   VDKPEEQSQPATLGVPQPLQLPIYQKGNKVATRRAYGDALLALGASQPDVVALDAEVSN
FT                   STYAEDFAEAFPERYFEMYIAEQQMIAAAVGLQVRKYKPFASTFAAFLTRGYDFIRMGA
FT                   VSRANIKLVGSHGGVSIGQDGASQMGLEDLAAFRAVCNSTVLYPSDANQTAKLVPQMSN
FT                   APGIVYLRTTRESTPVIYGSEEQFSIGGSKVIHRSERDQATIIAAGITVHEALKAYDRL
FT                   KNEGITARIIDAYSVKPIDVQTLHQAAKDTNGNLVVVEDHWPEGGLGAAVLDAFAGNST
FT                   TPAYKIPQLQIIKLAVQNMPTSGTPEELLHAAKIDADAIVEVVKSQVRRLVGVS"
     atgaccaccc aagagcaact atatcaatgg caagaactag ctcaacagtt gcgtgtggat        60
     agtattcgcg ctacaacgat cgcaggttca ggtcatccta cttcttctat gtcttccgct       120
     gatttgatgg cggtttttct atctaaatat cttcgctacg attttgatca tccagaaaat       180
     ccgaatagcg atcgctttat tctttccaaa ggacacgctg cacctctact atattccatg       240
     tataaagctg cgggggtcat ttctgaccaa gaattactat cattgcgtca gtctggtagc       300
     cgtttagaag gtcatcccac accaatttta ccttgggtgg atgtggcaac aggttctctc       360
     ggacaaggtt tacccattgg tgtgggggtg gctttggcag gtaaatattt agaccaatta       420
     ccttataatg tttgggtatt attgggggat ggtgaaacgg ctgaaggttc gatttgggaa       480
     gcttttgatc atgcttctca ctacacatta gataatctgc tcgccattat tgatgtcaac       540
     cggcttggtc aacgtggtca aactgaatta ggctggaata cacaagctta tggcaatcgt       600
     gctaaggctt ttggttggca agcaatagaa attgatggtc ataatttaac agaaattgac       660
     caagctttta gtgcagccgt ggctataaat gaccgtccca cggtgattat tgctaggaca       720
     aagaaaggta aaggtgtgaa ggctttagaa gatttaggtg gttggcatgg taaagcactg       780
     aaacaggatc aagaacaaca agctattacg gaactaggtg gagaacgtca cattaccatt       840
     accgttgata aaccagaaga acaaagccaa cccgctacac tgggagtacc tcaaccccta       900
     caacttccca tatatcaaaa aggcaataaa gtagccaccc gtcgcgctta tggagatgct       960
     ttattagctt taggcgcatc gcaacctgat gtggttgctc ttgatgcgga ggtgagtaat      1020
     tccacttatg cggaagattt cgccgaagct tttccagaac gctactttga gatgtacatt      1080
     gctgaacagc aaatgatagc agccgcagta ggcttgcagg tccgaaaata caaacccttt      1140
     gcttctactt ttgcagcttt tttaactcgt ggttacgact ttattaggat gggtgcggta      1200
     tctcgtgcca acattaagtt agttggttct catgggggtg tctccattgg tcaagatggt      1260
     gcttcccaaa tgggattaga agatttagca gcttttcgcg ctgtgtgtaa tagcactgta      1320
     ttgtatccca gtgatgctaa tcagactgct aaactagtac cacagatgag taatgcccct      1380
     ggtatagttt acctccgcac caccagagaa agcacacctg taatttatgg tagtgaagaa      1440
     caattttcca ttggtggcag caaagttatc caccggtccg agcgcgacca agccacaatt      1500
     attgccgcag gtatcactgt acatgaagcc ctcaaagctt atgacagatt gaaaaatgaa      1560
     gggatcacag cccgtattat tgatgcctat tccgttaaac ccattgatgt gcaaacacta      1620
     catcaagcag caaaagatac caacggtaat ttagtagttg tagaagatca ttggccagaa      1680
     ggaggattag gtgcggctgt cttagatgcc tttgctggta atagtaccac ccctgcctac      1740
     aaaattccgc aattacagat tattaaactt gcagttcaaa atatgccaac ttctggaact      1800
     cctgaagaac tactccatgc tgctaaaatt gatgcagatg ccattgtaga agttgtgaaa      1860
     tcacaagtta ggcgactggt aggagtatct tag                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page